catalog number :
MBS959475
products type :
Recombinant Protein
products full name :
Recombinant Human Protein S100-A9
products short name :
S100-A9
products name syn :
Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
other names :
protein S100-A9; Protein S100-A9; protein S100-A9; S100 calcium binding protein A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
products gene name :
S100A9
products gene name syn :
CAGB; CFAG; MRP14
other gene names :
S100A9; S100A9; MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387; CAGB; CFAG; MRP14; MRP-14; p14
uniprot entry name :
S10A9_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-114; Full length.
sequence :
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKEL
VRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEF
IMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products description :
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3. The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif
products references :
Two calcium-binding proteins in infiltrate macrophages of rheumatoid arthritis.Odink K., Cerletti N., Bruggen J., Clerc R.G., Tarcsay L., Zwaldo G., Gerhards G., Schlegel R., Sorg C.Nature 330:80-82(1987)
Cloning and expression of two human genes encoding calcium-binding proteins that are regulated during myeloid differentiation.Lagasse E., Clerc R.G.Mol. Cell. Biol. 8:2402-2410(1988)
A protein containing the cystic fibrosis antigen is an inhibitor of protein kinases.Murao S., Collart F.R., Huberman E.J. Biol. Chem. 264:8356-8360(1989)
Human gene for migration inhibitory factor-related protein 14 (MRP14)
, variant allele.Wang M., Xu X., Cai Y., Xu H., Han Y., Xu Z., Wu M.
ncbi acc num :
NP_002956.1
ncbi gb acc num :
NM_002965.3
ncbi summary :
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]
uniprot summary :
S100A9: a calcium-binding regulatory protein of the S-100 family expressed by macrophages in acutely inflammated tissues and in chronic inflammations. May be an inhibitor of protein kinases. Also expressed in epithelial cells constitutively or induced during dermatoses. May interact with components of the intermediate filaments in monocytes and epithelial cells. Interacts with CEACAM3 in a calcium-dependent manner. Protein type: Calcium-binding. Chromosomal Location of Human Ortholog: 1q21. Cellular Component: cytoskeleton; cytosol; extracellular region; extracellular space; nucleus; plasma membrane. Molecular Function: antioxidant activity; arachidonic acid binding; calcium ion binding; microtubule binding; protein binding; RAGE receptor binding; signal transducer activity; zinc ion binding. Biological Process: actin cytoskeleton reorganization; activation of NF-kappaB transcription factor; astrocyte development; autophagy; caspase activation; cell-cell signaling; chemokine production; cytokine production; defense response to bacterium; defense response to fungus; inflammatory response; innate immune response; leukocyte migration during inflammatory response; neutrophil chemotaxis; positive regulation of blood coagulation; positive regulation of cell growth; positive regulation of inflammatory response; positive regulation of peptide secretion; regulation of cytoskeleton organization and biogenesis; regulation of integrin biosynthetic process; regulation of translation; sequestering of zinc ion; signal transduction