catalog number :
MBS959365
products type :
Recombinant Protein
products full name :
Recombinant Mouse Potassium voltage-gated channel subfamily A member 2 (Kcna2)
products short name :
Potassium voltage-gated channel subfamily A member 2 (Kcna2)
products name syn :
Recombinant Potassium voltage-gated channel subfamily A member 2 (Kcna2); Potassium voltage-gated channel subfamily A member 2; MK2 Voltage-gated potassium channel subunit Kv1.2
other names :
potassium voltage-gated channel subfamily A member 2; Potassium voltage-gated channel subfamily A member 2; potassium voltage-gated channel subfamily A member 2; MK2; voltage-gated potassium channel subunit Kv1.2; potassium voltage-gated channel, shaker-related subfamily, member 2; MK2; Voltage-gated potassium channel subunit Kv1.2
products gene name syn :
Kcna2
other gene names :
Kcna2; Kcna2; Mk-2; Kv1.2; Akr6a4; Kca1-2; Gm10672; ENSMUSG00000074335
uniprot entry name :
KCNA2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-499
sequence :
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINI
SGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFF
DRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE
LGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYP
ESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDM
HGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFS
FEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTE
LAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEA
DERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQY
LQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNS
NEDFREENLKTANCTLANTNYVNITKMLTDV
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Mus musculus (Mouse)
products description :
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:12527813, PubMed:21233214). Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel (PubMed:20696761). Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels (By similarity). In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure (PubMed:23864368). In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation (PubMed:23864368). Contributes to the regulation of action potentials in neurons (PubMed:12527813, PubMed:17925011). KCNA2-containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing (PubMed:17634333, PubMed:17925011). Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons (By similarity). Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination (By similarity). KCNA2-containing channels play a role in GABAergic transmission from basket cells to Purkinje cells in the cerebellum, and thereby play an import role in motor coordination (PubMed:20696761). Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus (PubMed:23981714). May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons (By similarity). May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) (By similarity). Contributes to the regulation of the axonal release of the neurotransmitter dopamine (PubMed:21233214). Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain (By similarity). Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep (PubMed:17925011).
ncbi acc num :
NP_032443.3
ncbi gb acc num :
NM_008417.5
ncbi pathways :
Neuronal System Pathway (640646); Potassium Channels Pathway (640703); Voltage Gated Potassium Channels Pathway (640712)
uniprot summary :
Kv1.2: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.2/KCNA2 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral. Cellular Component: voltage-gated potassium channel complex; neuron projection; integral to plasma membrane; endoplasmic reticulum; dendrite; integral to membrane; perikaryon; cell projection; membrane; axon; lamellipodium; plasma membrane; synapse; nerve terminal; cell junction. Molecular Function: protein binding; voltage-gated potassium channel activity; potassium channel activity; outward rectifier potassium channel activity; delayed rectifier potassium channel activity; ion channel activity; voltage-gated ion channel activity. Biological Process: optic nerve structural organization; transport; generation of action potential; ion transport; regulation of circadian sleep/wake cycle, non-REM sleep; sensory perception of pain; transmembrane transport; regulation of dopamine secretion; potassium ion transport; protein homooligomerization; protein oligomerization