Recombinant Kininogen-1 | MyBioSource MBS959356 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Kininogen-1

catalog :

MBS959356

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS959356

products type :

Recombinant Protein

products full name :

Recombinant Kininogen-1

products short name :

Kininogen-1

other names :

kininogen-1 isoform 1; Kininogen-1; kininogen-1; kininogen 2

products gene name :

Kng1

other gene names :

Kng2; Kng1; Kng1; Kngk; KINKG; KINKH; Kng

uniprot entry name :

KNG1_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

390-639

sequence length :

639

sequence :

APRVKKPKESTTVSPSYIARVQEERDPGNEQGPIHGHGW
LHAKQIKNKNHQGHKHGHGIGHGHQKPHGLGHGHQLKLD
DLKQQREDGYDHRHPVGHGHGQRHGHGHGHGHGRDKHTN
KDKNNVKHTDQRRAPLTSSSEDNTTSTQIQGRTEGFTLN
PPLAQPAVISRGFQDSGFTEGVIATTSPYDTETHDDLIP
DIHVQPDSLSFKLISDFPEATSHKCPGRPWKPVSRKDPT
IETTEFSDFDLLDALS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e. g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.

products references :

Differing expression patterns and evolution of the rat kininogen gene family.Kitagawa H., Kitamura N., Hayashida H., Miyata T., Nakanishi S.J. Biol. Chem. 262:2190-2198(1987) Primary structures of the mRNAs encoding the rat precursors for bradykinin and T-kinin. Structural relationship of kininogens with major acute phase protein and alpha 1-cysteine proteinase inhibitor.Furuto-Kato S., Matsumoto A., Kitamura N., Nakanishi S.J. Biol. Chem. 260:12054-12059(1985) Structure and expression of the genes for major acute phase alpha 1-protein (thiostatin) and kininogen in the rat.Fung W.-P., Schreiber G.J. Biol. Chem. 262:9298-9308(1987) Differing utilization of homologous transcription initiation sites of rat K and T kininogen genes under inflammation condition.Kageyama R., Kitamura N., Ohkubo H., Nakanishi S.J. Biol. Chem. 262:2345-2351(1987)

ncbi gi num :

7549773

ncbi acc num :

NP_036873.1

ncbi gb acc num :

NM_012741.1

uniprot acc num :

P08934

ncbi mol weight :

29.7kD

ncbi pathways :

Complement And Coagulation Cascades Pathway (83465); Complement And Coagulation Cascades Pathway (484)

ncbi summary :

precursor protein of kinin which is found in plasma; cysteine protease inhibitor and a major acute phase reactant [RGD, Feb 2006]

uniprot summary :

KNG1: (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting. Protein type: Motility/polarity/chemotaxis; Contractile; Inhibitor; Cell adhesion; Secreted, signal peptide; Secreted. Cellular Component: cytosol. Biological Process: blood coagulation; elevation of cytosolic calcium ion concentration; inflammatory response; negative regulation of blood coagulation; vasodilation

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1415

more info or order :

MyBioSource product webpage