Recombinant Human Myelin-associated glycoprotein | MyBioSource MBS959179 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Myelin-associated glycoprotein

catalog :

MBS959179

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS959179

products type :

Recombinant Protein

products full name :

Recombinant Human Myelin-associated glycoprotein

products short name :

Myelin-associated glycoprotein

products name syn :

Siglec-4a

other names :

myelin-associated glycoprotein isoform c; Myelin-associated glycoprotein; myelin-associated glycoprotein; myelin associated glycoprotein; Siglec-4a

products gene name :

MAG

other gene names :

MAG; MAG; GMA; S-MAG; SIGLEC4A; SIGLEC-4A; GMA

uniprot entry name :

MAG_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

25-516;Provide the extracellular domain

sequence length :

516

sequence :

WMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNS
PYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTL
LLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTP
NIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQA
SFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVS
LLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTP
AEDGVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMV
AVEGETVSILCSTQSNPDPILTIFKEKQILSTVIYESEL
QLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPV
LLLESHCAAARDTVQCLCVVKSNPEPSVAFELPSRNVTV
NESEREFVYSERSGLVLTSILTLRGQAQAPPRVICTARN
LYGAKSLELPFQGAHRLMWAKIGP

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Adhesion

products description :

Adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3-linked sialic acid.

products references :

cDNA cloning and amino acid sequence for human myelin-associated glycoprotein.Sato S., Fujita N., Kurihara T., Kuwano R., Sakimura K., Takahashi Y., Miyatake T.Biochem. Biophys. Res. Commun. 163:1473-1480(1989) Molecular cloning of human myelin-associated glycoprotein.Spagnol G., Williams M., Srinivasan J., Golier J., Bauer D., Lebo R.V., Latov N.J. Neurosci. Res. 24:137-142(1989) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Identification of the glycosylated sequons of human myelin-associated glycoprotein.Burger D., Pidoux L., Steck A.J.Biochem. Biophys. Res. Commun. 197:457-464(1993)

ncbi gi num :

312836851

ncbi acc num :

NP_001186145.1

ncbi gb acc num :

NM_001199216.1

uniprot acc num :

P20916

ncbi mol weight :

70.1kD

ncbi pathways :

Axonal Growth Inhibition (RHOA Activation) Pathway (1269458); Basigin Interactions Pathway (1269376); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Cell Surface Interactions At The Vascular Wall Pathway (1269373); Glial Cell Differentiation Pathway (698758); Hemostasis Pathway (1269340); Signal Transduction Pathway (1269379); Signalling By NGF Pathway (1269443); Spinal Cord Injury Pathway (739007)

ncbi summary :

The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2010]

uniprot summary :

MAG: Adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3- linked sialic acid. Binds to RTN4R. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Membrane protein, integral. Chromosomal Location of Human Ortholog: 19q13.1. Cellular Component: cytoplasm; integral to membrane; paranode region of axon; plasma membrane. Molecular Function: carbohydrate binding; protein kinase binding; receptor binding. Biological Process: blood coagulation; cell adhesion; leukocyte migration; negative regulation of axonogenesis; nerve growth factor receptor signaling pathway; positive regulation of astrocyte differentiation; positive regulation of myelination; regulation of axonogenesis; substantia nigra development

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

490

size4 :

0.2 mg (Yeast)

price4 :

600

size5 :

0.5 mg (E-Coli)

price5 :

715

more info or order :

MyBioSource product webpage