catalog number :
MBS959069
products type :
Recombinant Protein
products full name :
Recombinant Human Protein Wnt-2
products short name :
Wnt-2
products name syn :
Int-1-like protein 1; Int-1-related protein; IRP
other names :
protein Wnt-2; Protein Wnt-2; protein Wnt-2; wingless-type MMTV integration site family member 2; Int-1-like protein 1; Int-1-related protein; IRP
products gene name :
WNT2
other gene names :
WNT2; WNT2; IRP; INT1L1; INT1L1; IRP; IRP
uniprot entry name :
WNT2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
26-360
sequence :
SWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRA
ISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLR
SSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKM
GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKD
ARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTC
WLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANER
FKKPTKNDLVYFENSPDYCIR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cancer
products description :
Ligand for mbers of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
products references :
Isolation of a human gene with protein sequence similarity to human and murine int-1 and the Drosophila segment polarity mutant wingless.Wainwright B.J., Scambler P.J., Stanier P., Watson E.K., Bell G., Wicking C., Estivill X., Courtney M., Boue A., Pedersen P.S., Williamson R., Farrall M.EMBO J. 7:1743-1748(1988)
ncbi acc num :
NP_003382.1
ncbi gb acc num :
NM_003391.2
ncbi summary :
This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
WNT2: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family. Protein type: Cell adhesion; Cell development/differentiation; Extracellular matrix; Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 7q31.2. Cellular Component: cytoplasm; extracellular matrix; extracellular region; extracellular space; plasma membrane; proteinaceous extracellular matrix. Molecular Function: cytokine activity; frizzled binding; protein binding; receptor agonist activity. Biological Process: atrial cardiac muscle morphogenesis; cell fate commitment; cell proliferation in midbrain; cell-cell signaling; lens development in camera-type eye; lung development; neuron differentiation; positive regulation of cardiac muscle cell proliferation; positive regulation of cell proliferation; positive regulation of endothelial cell proliferation; positive regulation of fibroblast proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin
size4 :
0.05 mg (Baculovirus)