protein

Recombinant Human DNA-dependent protein kinase catalytic subunit (PRKDC), partial

MBS958970

0.5 mg (E-Coli)

1055 USD

Recombinant Protein

Recombinant Human DNA-dependent protein kinase catalytic subunit (PRKDC), partial

DNA-dependent protein kinase catalytic subunit (PRKDC), partial

DNA-dependent protein kinase catalytic subunit; DNA-PK catalytic subunit; DNA-PKcs; EC=2.7.11.1; DNPK1; p460

DNA-dependent protein kinase catalytic subunit isoform 2; DNA-dependent protein kinase catalytic subunit; DNA-dependent protein kinase catalytic subunit; p460; DNA-PK catalytic subunit; hyper-radiosensitivity of murine scid mutation, complementing 1; protein kinase, DNA-activated, catalytic polypeptide; DNPK1; p460

PRKDC

PRKDC; HYRC; HYRC1

PRKDC; PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; XRCC7; DNA-PKcs; HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs

PRKDC_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

3747-4015; PI3K/PI4K domain

4015

EHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRA
LQLRTYSVVPMTSRLGLIEWLENTVTLKDLLLNTMSQEE
KAAYLSDPRAPPCEYKDWLTKMSGKHDVGAYMLMYKGAN
RTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRS
HFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGID
FGHAFGSATQFLPVPELMPFRLTRQFINLMLPMKETGLM
YSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKN

>90%

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Species: Homo sapiens (Human)

126032350

NP_001075109.1

NM_001081640.1

P78527

465,501 Da

BARD1 Signaling Events Pathway (137959); Cell Cycle Pathway (198811); Cell Cycle Pathway (83054); Cell Cycle Pathway (463); Class I PI3K Signaling Events Mediated By Akt Pathway (138020); Coregulation Of Androgen Receptor Activity Pathway (138085); Cytosolic Sensors Of Pathogen-associated DNA Pathway (576255); DNA Repair Pathway (105837); DNA-PK Complex Pathway (413430); Double-Strand Break Repair Pathway (105861)

This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.[provided by RefSeq, Jul 2010]

DNAPK: an atypical protein kinase of the PIKK family. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. and modulation of transcription. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Defects cause severe combined immune deficiency (SCID) which is characterized by a lack of mature functional lymphocytes and a high susceptibility to lethal opportunistic infections. Required for repair of radiation-induced dsDNA breaks. Loss of function in mice or horses leads to the SCID (severe combined immune deficiency) phenotype due to failure of immunoglobulin rearrangement. Target of mutation in mismatch repair-deficient colorectal cancer. Inhibitor: KU-7059. 2 isoforms of the human protein are produced by alternative splicing. Protein type: DNA repair, damage; Kinase, protein; Protein kinase, atypical; Protein kinase, Ser/Thr (non-receptor); Nucleolus; EC 2.7.11.1; ATYPICAL group; PIKK family; DNAPK subfamily. Chromosomal Location of Human Ortholog: 8q11. Cellular Component: nucleoplasm; transcription factor complex; membrane; nucleolus; DNA-dependent protein kinase complex; cytosol. Molecular Function: protein serine/threonine kinase activity; protein binding; enzyme binding; DNA binding; DNA-dependent protein kinase activity; transcription factor binding; ATP binding; protein kinase activity. Biological Process: positive regulation of apoptosis; heart development; germ cell programmed cell death; T cell differentiation in the thymus; rhythmic process; double-strand break repair via nonhomologous end joining; negative regulation of protein amino acid phosphorylation; double-strand break repair; positive regulation of interferon type I production; response to gamma radiation; telomere maintenance; pro-B cell differentiation; somitogenesis; protein destabilization; immunoglobulin V(D)J recombination; B cell lineage commitment; protein modification process; regulation of circadian rhythm; DNA repair; double-strand break repair via homologous recombination; T cell lineage commitment; peptidyl-serine phosphorylation; DNA damage response, signal transduction resulting in induction of apoptosis; cellular response to insulin stimulus; innate immune response; T cell receptor V(D)J recombination; positive regulation of transcription from RNA polymerase II promoter; brain development. Disease: Immunodeficiency 26 With Or Without Neurologic Abnormalities

0.5 mg (E-Coli)

1055 USD

0.05 mg (Baculovirus)

1055

0.05 mg (Mammalian-Cell)

1285

0.5 mg (Yeast)

1285

1 mg (E-Coli)

1595