Recombinant Mouse Connective tissue growth factor | MyBioSource MBS958904 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Connective tissue growth factor

catalog :

MBS958904

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS958904

products type :

Recombinant Protein

products full name :

Recombinant Mouse Connective tissue growth factor

products short name :

Connective tissue growth factor

products name syn :

CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Protein FISP-12

other names :

connective tissue growth factor; Connective tissue growth factor; connective tissue growth factor; connective tissue growth factor; CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Protein FISP-12

products gene name :

Ctgf

other gene names :

Ctgf; Ctgf; Ccn2; Hcs24; Fisp12; fisp-12; Ccn2; Fisp-12; Fisp12; Hcs24

uniprot entry name :

CTGF_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

26-344

sequence length :

344

sequence :

QDCSAQCQCAAEAAPHCPAGVSLVLDGCGCCRVCAKQLG
ELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCV
FGGSVYRSGESFQSSCKYQCTCLDGAVGCVPLCSMDVRL
PSPDCPFPRRVKLPGKCCEEWVCDEPKDRTAVGPALAAY
RLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRV
TNDNTFCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTP
KIAKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTT
TLPVEFKCPDGEIMKKNMMFIKTCACHYNCPGDNDIFES
LYYRKMY

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

products references :

Structure, mapping, and expression of fisp-12, a growth factor-inducible gene encoding a secreted cysteine-rich protein.Ryseck R.-P., Macdonald-Bravo H., Mattei M.-G., Bravo R.Cell Growth Differ. 2:225-233(1991) Identification of a gene family regulated by transforming growth factor-beta.Brunner A., Chinn J., Neubauer M.G., Purchio A.F.DNA Cell Biol. 10:293-300(1991) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Cyr61 and Fisp12 are both ECM-associated signaling molecules activities, metabolism, and localization during development.Kireeva M.L., Latinkic B.V., Kolesnikova T.V., Chen C.-C., Yang G.P., Abler A.S., Lau L.F.Exp. Cell Res. 233:63-77(1997) Fisp12/mouse connective tissue growth factor mediates endothelial cell adhesion and migration through integrin alphavbeta3, promotes endothelial cell survival, and induces angiogenesis in vivo.Babic A.M., Chen C.-C., Lau L.F.Mol. Cell. Biol. 19:2958-2966(1999)

ncbi gi num :

171846283

ncbi acc num :

NP_034347.2

ncbi gb acc num :

NM_010217.2

uniprot acc num :

P29268

ncbi mol weight :

62.4kD

ncbi pathways :

Hippo Signaling Pathway (749786); Hippo Signaling Pathway (750388); PodNet: Protein-protein Interactions In The Podocyte Pathway (755428); XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway (755427)

uniprot summary :

CTGF: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Belongs to the CCN family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted, signal peptide; Secreted; Cell adhesion. Cellular Component: cell cortex; cis-Golgi network; cytosol; extracellular region; extracellular space; Golgi apparatus; intracellular membrane-bound organelle; perinuclear region of cytoplasm; proteinaceous extracellular matrix. Molecular Function: fibronectin binding; growth factor activity; heparin binding; insulin-like growth factor binding; integrin binding; protein C-terminus binding. Biological Process: angiogenesis; cartilage condensation; cell adhesion; cell differentiation; cell migration; cell-cell signaling; cell-matrix adhesion; fibroblast growth factor receptor signaling pathway; integrin-mediated signaling pathway; lung development; ossification; positive regulation of caspase activity; positive regulation of cell activation; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of collagen biosynthetic process; positive regulation of JNK cascade; positive regulation of protein amino acid phosphorylation; positive regulation of stress fiber formation; regulation of cell growth; regulation of chondrocyte differentiation; tissue homeostasis

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

1 mg (E-Coli)

price5 :

1170

more info or order :

MyBioSource product webpage