product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Serum amyloid A-1 protein
catalog :
MBS958787
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS958787
products type :
Recombinant Protein
products full name :
Recombinant Mouse Serum amyloid A-1 protein
products short name :
Serum amyloid A-1
products name syn :
Mus musculus (Mouse)
other names :
serum amyloid A-1 protein; Serum amyloid A-1 protein; serum amyloid A-1 protein; serum amyloid A 1
products gene name :
Saa1
other gene names :
Saa1; Saa1; Saa2; Saa-1
uniprot entry name :
SAA1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-122, Mature full length protein.
sequence length :
122
sequence :
GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARG
NYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIAD
QEANRHGRSGKDPNYYRPPGLPDKY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Major acute phase protein
products references :
Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences." Yamamoto K., Migita S. Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)
ncbi gi num :
6677843
ncbi acc num :
NP_033143.1
ncbi gb acc num :
NM_009117.3
uniprot acc num :
P05366
ncbi mol weight :
27.75kD
uniprot summary :
SAA1: Major acute phase reactant. Apolipoprotein of the HDL complex. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA1 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Elevated serum SAA1 protein levels may be associated with lung cancer. Belongs to the SAA family. Protein type: Secreted; Secreted, signal peptide. Cellular Component: cytoplasmic microtubule; cytosol; extracellular region; extracellular space. Molecular Function: chemoattractant activity; G-protein-coupled receptor binding; heparin binding; protein binding. Biological Process: acute-phase response; cholesterol metabolic process
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
835
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1060
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!