Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG) | MyBioSource MBS958780 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG)

catalog :

MBS958780

quantity :

1 mg (E-Coli)

price :

1325 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS958780

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG)

products short name :

(Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG)

products name syn :

Recombinant (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG); Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L Fas antigen ligand; Fas ligand; FasL CD_antigen= CD178 Cleaved into the following 4 chains: 1. T

other names :

tumor necrosis factor ligand superfamily member 6; Tumor necrosis factor ligand superfamily member 6; tumor necrosis factor ligand superfamily member 6; CD95 ligand; FAS antigen CD95; fas antigen ligand; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD_antigen: CD178Cleaved into the following 4 chains:Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble formAlternative name(s):Receptor-binding FasL ectodomain; Soluble Fas ligand; sFasL

products gene name syn :

FASLG; CD95L, FASL, TNFSF6

other gene names :

FASLG; FASLG; FASL; CD95L; CD95-L; TNFSF6; CD95L; FASL; TNFSF6; CD95-L; Fas ligand; FasL; sFasL; APL; FasL ICD; SPA

uniprot entry name :

TNFL6_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

102-280

sequence length :

280

sequence :

QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKK
EQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYP
QDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLY
VNVSELSLVNFEESQTFFGLYKL

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

ncbi gi num :

74136237

ncbi acc num :

NP_001028010.1

ncbi gb acc num :

NM_001032838.1

uniprot acc num :

P63307

ncbi mol weight :

31,368 Da

ncbi pathways :

African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Apoptosis Pathway (86730); Apoptosis Pathway (470); Autoimmune Thyroid Disease Pathway (86787); Autoimmune Thyroid Disease Pathway (533); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795)

uniprot summary :

Function: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects . By similarity.The FasL intracellular domain (FasL ICD) cytoplasmic form induces gene transcription inhibition . By similarity. Subunit structure: Homotrimer . Probable. Interacts with ARHGAP9, BAIAP2L1, BTK, CACNB3, CACNB4, CRK, DLG2, DNMBP, DOCK4, EPS8L3, FGR, FYB, FYN, HCK, ITK, ITSN2, KALRN, LYN, MACC1, MIA, MPP4, MYO15A, NCF1, NCK1, NCK2, NCKIPSD, OSTF1, PIK3R1, PSTPIP1, RIMBP3C, SAMSN1, SH3GL3, SH3PXD2B, SH3PXD2A, SH3RF2, SKAP2, SNX33, SNX9, SORBS3, SPTA1, SRC, SRGAP1, SRGAP2, SRGAP3, TEC, TJP3 and YES1 . By similarity. Subcellular location: Cell membrane; Single-pass type II membrane protein . By similarity. Cytoplasmic vesicle lumen . By similarity. Lysosome lumen . By similarity. Note: Colocalizes with the SPPL2A protease at the cell membrane. Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination . By similarity.Tumor necrosis factor ligand superfamily member 6, soluble form: Secreted . By similarity. Note: May be released into the extracellular fluid, probably by cleavage form the cell surface . By similarity.FasL intracellular domain: Nucleus . By similarity. Note: The FasL ICD cytoplasmic form is translocated into the nucleus . By similarity. Post-translational modification: The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form undergoes two successive intramembrane proteolytic cleavages. The first one is processed by ADAM10 producing an N-terminal fragment, which lacks the receptor-binding extracellular domain. This ADAM10-processed FasL (FasL APL) remnant form is still membrane anchored and further processed by SPPL2A that liberates the FasL intracellular domain (FasL ICD). FasL shedding by ADAM10 is a prerequisite for subsequent intramembrane cleavage by SPPL2A in T-cells . By similarity.Phosphorylated by FGR on tyrosine residues; this is required for ubiquitination and subsequent internalization . By similarity.N-glycosylated . By similarity.Monoubiquitinated . By similarity. Sequence similarities: Belongs to the tumor necrosis factor family.

size1 :

1 mg (E-Coli)

price1 :

1325 USD

size2 :

1 mg (Yeast)

price2 :

1785

more info or order :

MyBioSource product webpage