protein

Recombinant Human Wilms tumor protein

MBS958692

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Wilms tumor protein

Wilms tumor protein

WT33

Wilms tumor protein isoform A; Wilms tumor protein; Wilms tumor protein; Wilms tumor 1; WT33

WT1

WT1; WT1; GUD; AWT1; WAGR; WT33; NPHS4; WIT-2; EWS-WT1

WT1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-449; The full length of Isoform 1

449

MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLD
FAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSW
GGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPP
SQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDG
TPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSV
PPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLE
CMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYES
DNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVR
SASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEK
PYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQR
KFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSD
ELVRHHNMHQRNMTKLQLAL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transcription

Transcription factor that plays an important role in cellular development and cell survival. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA.

Homozygous deletion in Wilms tumours of a zinc-finger gene identified by chromosome jumping.Gessler M., Poustka A., Cavenee W., Neve R.L., Orkin S.H., Bruns G.A.P.Nature 343:774-778(1990) Alternative splicing and genomic structure of the Wilms tumor gene WT1.Haber D.A., Sohn R.L., Buckler A.J., Pelletier J., Call K.M., Housman D.E.Proc. Natl. Acad. Sci. U.S.A. 88:9618-9622(1991) The genomic organization and expression of the WT1 gene.Gessler M., Konig A., Bruns G.A.P.Genomics 12:807-813(1992) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) NIEHS SNPs programHuman chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

65507714

NP_000369.3

NM_000378.4

P19544

65.2kD

Integrated Pancreatic Cancer Pathway (711360); Regulation Of Telomerase Pathway (137987); Transcriptional Misregulation In Cancer Pathway (523016); Transcriptional Misregulation In Cancer Pathway (522987)

This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq, Mar 2015]

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

260

0.2 mg (E-Coli)

490

0.2 mg (Yeast)

600

0.5 mg (E-Coli)

715