product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human ATP synthase subunit gamma, mitochondrial (ATP5C1)
catalog :
MBS958676
quantity :
0.05 mg (E-Coli)
price :
675 USD
more info or order :
product information
catalog number :
MBS958676
products type :
Recombinant Protein
products full name :
Recombinant Human ATP synthase subunit gamma, mitochondrial (ATP5C1)
products short name :
[ATP synthase subunit gamma, mitochondrial (ATP5C1)]
other names :
[ATP synthase subunit gamma, mitochondrial isoform L (liver); ATP synthase subunit gamma, mitochondrial; ATP synthase subunit gamma, mitochondrial; ATP synthase F1 subunit gamma; F-ATPase gamma subunit]
products gene name :
[ATP5C1]
other gene names :
[ATP5F1C; ATP5C1; ATP5C; ATP5C1; ATP5CL1; ATP5C; ATP5CL1]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[26-298aa. Full Length of Mature Protein]
sequence :
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELK
PARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLC
GAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILY
RTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFD
EGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDD
IDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDN
ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products description :
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene also has a pseudogene on chromosome 14.
ncbi gi num :
50345988
ncbi acc num :
NP_001001973.1
ncbi gb acc num :
NM_001001973.2
uniprot acc num :
P36542
ncbi mol weight :
32,881 Da
ncbi pathways :
Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Electron Transport Chain Pathway (198860); F-type ATPase, Eukaryotes Pathway (522535); Formation Of ATP By Chemiosmotic Coupling Pathway (105922); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolism Pathway (477135); Oxidative Phosphorylation Pathway (82942); Oxidative Phosphorylation Pathway (303)
ncbi summary :
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene also has a pseudogene on chromosome 14. [provided by RefSeq, Jul 2008]
uniprot summary :
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha3beta3. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
size1 :
0.05 mg (E-Coli)
price1 :
675 USD
size2 :
0.05 mg (Yeast)
price2 :
810
size3 :
0.2 mg (E-Coli)
price3 :
910
size4 :
0.5 mg (E-Coli)
price4 :
995
size5 :
0.05 mg (Baculovirus)
price5 :
1020
size6 :
0.2 mg (Yeast)
price6 :
1090
size7 :
0.5 mg (Yeast)
price7 :
1235
size8 :
0.05 mg (Mammalian-Cell)
price8 :
1265
size9 :
0.1 mg (Baculovirus)
price9 :
1475
size10 :
1 mg (E-Coli)
price10 :
1505
size11 :
0.5 mg (Baculovirus)
price11 :
1925
size12 :
1 mg (Yeast)
price12 :
1945
size13 :
0.1 mg (Mammalian-Cell)
price13 :
2055
size14 :
1 mg (Baculovirus)
price14 :
2990
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!