catalog number :
MBS958567
products type :
Recombinant Protein
products full name :
Recombinant Mouse Lipoprotein lipase (Lpl)
products short name :
[Lipoprotein lipase (Lpl)]
other names :
[lipoprotein lipase; Lipoprotein lipase; lipoprotein lipase; lipoprotein lipase]
products gene name :
[Lpl]
other gene names :
[Lpl; Lpl; LPL]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[28-474. Full Length of Mature Protein]
sequence :
ADAGRDFSDIESKFALRTPEDTAEDTCHLIPGLADSVSN
CHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPD
SNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWMEE
EFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLD
PAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIG
IQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVD
QLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYK
VFHYQVKIHFSGTEDGKQHNQAFEISLYGTVAESENIPF
TLPEVSTNKTYSFLIYTEVDIGELLMMKLKWISDSYFSW
PDWWSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKG
KDSAVFVKCHDKSLKKSG
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mouse
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Baculovirus host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirushost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand. bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
ncbi acc num :
NP_032535.2
ncbi gb acc num :
NM_008509.2
ncbi mol weight :
53,109 Da
ncbi pathways :
Adipogenesis Pathway (198299); Alzheimer's Disease Pathway (83294); Alzheimer's Disease Pathway (509); Chylomicron-mediated Lipid Transport Pathway (1324269); Fatty Acid Beta Oxidation Pathway (198349); Glycerolipid Metabolism Pathway (83185); Glycerolipid Metabolism Pathway (361); Lipid Digestion, Mobilization, And Transport Pathway (1324265); Lipoprotein Metabolism Pathway (1324268); Metabolism Pathway (1324226)
uniprot summary :
The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium.
size2 :
0.01 mg (Baculovirus)
size4 :
0.02 mg (Baculovirus)
size6 :
0.05 mg (Baculovirus)
size9 :
0.1 mg (Baculovirus)
size12 :
0.05 mg (Mammalian-Cell)
size14 :
0.5 mg (Baculovirus)
size16 :
1 mg (Baculovirus)
size17 :
0.1 mg (Mammalian-Cell)