Recombinant Human CD81 antigen | MyBioSource MBS958486 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human CD81 antigen

catalog :

MBS958486

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS958486

products type :

Recombinant Protein

products full name :

Recombinant Human CD81 antigen

products short name :

CD81 antigen

products name syn :

26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; Tetraspanin-28; Tspan-28; CD81

other names :

CD81 antigen isoform 2; CD81 antigen; CD81 antigen; CD81 molecule; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; Tetraspanin-28; Tspan-28; CD_antigen: CD81

products gene name :

CD81

other gene names :

CD81; CD81; S5.7; CVID6; TAPA1; TSPAN28; TAPA1; TSPAN28; Tspan-28

uniprot entry name :

CD81_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

113-201;Partial.

sequence length :

201

sequence :

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFH
ETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDC
HQKIDDLFSGK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

products references :

TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)

ncbi gi num :

663071018

ncbi acc num :

NP_001284578.1

ncbi gb acc num :

NM_001297649.1

uniprot acc num :

P60033

ncbi mol weight :

25.8kD

ncbi pathways :

Adaptive Immune System Pathway (1269171); B Cell Receptor Signaling Pathway (198909); B Cell Receptor Signaling Pathway (83081); B Cell Receptor Signaling Pathway (492); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Immune System Pathway (1269170); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (1269201); Malaria Pathway (152665); Malaria Pathway (152657)

ncbi summary :

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

uniprot summary :

CD81: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV. Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6); also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the tetraspanin (TM4SF) family. Protein type: Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 11p15.5. Cellular Component: apical plasma membrane; focal adhesion; immunological synapse; integral to plasma membrane; membrane; plasma membrane; vesicle. Molecular Function: protein binding. Biological Process: activation of MAPK activity; cell proliferation; cell surface receptor linked signal transduction; entry of virus into host cell; positive regulation of 1-phosphatidylinositol 4-kinase activity; positive regulation of B cell proliferation; positive regulation of cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription from RNA polymerase II promoter; protein localization; receptor internalization; regulation of growth; regulation of immune response; regulation of protein stability; response to wounding; virion attachment, binding of host cell surface receptor. Disease: Immunodeficiency, Common Variable, 6

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

490

size4 :

0.2 mg (Yeast)

price4 :

600

size5 :

0.5 mg (E-Coli)

price5 :

715

more info or order :

MyBioSource product webpage