SLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLAD
RVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPG
SMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSA
VSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKK
PSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPS
LAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATG
LF

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Mannan-binding lectin serine protease 1 (MASP1) | MBS958279
- Recombinant Human Acyloxyacyl hydrolase (AOAH) | MBS958374
- Recombinant human Endothelial protein C receptor | MBS958456
- Recombinant Human 4-aminobutyrate aminotransferase, mitochondrial (ABAT)
- Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (F ...
