product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Serum amyloid A-2 protein
catalog :
MBS958063
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS958063
products type :
Recombinant Protein
products full name :
Recombinant Mouse Serum amyloid A-2 protein
products short name :
Serum amyloid A-2
products name syn :
Amyloid fibril protein AA
other names :
serum amyloid A-2 protein; Serum amyloid A-2 protein; serum amyloid A-2 protein; serum amyloid A 2; Amyloid protein AAlternative name(s):Amyloid fibril protein AA
products gene name :
Saa2
other gene names :
Saa2; Saa2; Saa1; Saa-2; AW111173
uniprot entry name :
SAA2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-122
sequence length :
122
sequence :
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARG
NYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMAD
QEANRHGRSGKDPNYYRPPGLPAKY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Major acute phase reactant. Apolipoprotein of the HDL complex.
products references :
Structure of the murine serum amyloid A gene family. Gene conversion.Lowell C.A., Potter D.A., Stearman R.S., Morrow J.F.J. Biol. Chem. 261:8442-8452(1986) Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences.Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985) Structural diversity of murine serum amyloid A genes. Evolutionary implications.Yamamoto K., Goto N., Kosaka J., Shiroo M., Yeul Y.D., Migita S.J. Immunol. 139:1683-1688(1987) Mouse serum amyloid A protein. Complete amino acid sequence and mRNA analysis of a new isoform.de Beer M.C., de Beer F.C., Beach C.M., Carreras I., Sipe J.D.Biochem. J. 283:673-678(1992)
ncbi gi num :
6755394
ncbi acc num :
NP_035444.1
ncbi gb acc num :
NM_011314.2
uniprot acc num :
P05367
ncbi mol weight :
15.7kD
uniprot summary :
SAA2: Major acute phase reactant. Apolipoprotein of the HDL complex. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Belongs to the SAA family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: cytoplasmic microtubule; cytosol; extracellular region; extracellular space. Molecular Function: chemoattractant activity; G-protein-coupled receptor binding; protein binding. Biological Process: acute-phase response
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
835
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1060
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!