product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Ephrin-A1
catalog :
MBS958041
quantity :
0.05 mg (E-Coli)
price :
175 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS958041
products type :
Recombinant Protein
products full name :
Recombinant Rat Ephrin-A1
products short name :
Ephrin-A1
products name syn :
EPH-related receptor tyrosine kinase ligand 1; LERK-1; Immediate early response protein B61
other names :
ephrin-A1; Ephrin-A1; ephrin-A1; ephrin A1; EPH-related receptor tyrosine kinase ligand 1; LERK-1
products gene name :
Efna1
other gene names :
Efna1; Efna1; B61; Epgl1; Lerk1; LERK-1
uniprot entry name :
EFNA1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
18-182
sequence length :
205
sequence :
ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYED
DSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQP
SAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIY
HQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEV
QVLHSIGHS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
products references :
Molecular cloning and expression of rat and mouse B61 gene implications on organogenesis.Takahashi H., Ikeda T.Oncogene 11:879-883(1995)
ncbi gi num :
61889105
ncbi acc num :
NP_446051.2
ncbi gb acc num :
NM_053599.2
uniprot acc num :
P97553
ncbi mol weight :
23.5kD
ncbi pathways :
Axon Guidance Pathway (83457); Axon Guidance Pathway (476); Axon Guidance Pathway (1333217); Developmental Biology Pathway (1333216); EPH-Ephrin Signaling Pathway (1333237); EPH-ephrin Mediated Repulsion Of Cells Pathway (1333241); EPHA-mediated Growth Cone Collapse Pathway (1333238); PI3K-Akt Signaling Pathway (692247); PI3K-Akt Signaling Pathway (692979); Rap1 Signaling Pathway (869320)
ncbi summary :
ligand of receptor tyrosine kinases; involved in thymic function and development [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
175 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
580
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!