Recombinant Rat Muscarinic acetylcholine receptor M1 | MyBioSource MBS958005 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Muscarinic acetylcholine receptor M1

catalog :

MBS958005

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS958005

products type :

Recombinant Protein

products full name :

Recombinant Rat Muscarinic acetylcholine receptor M1

products short name :

Muscarinic acetylcholine receptor M1

other names :

muscarinic acetylcholine receptor M1; Muscarinic acetylcholine receptor M1; muscarinic acetylcholine receptor M1; cholinergic receptor, muscarinic 1

products gene name :

Chrm1

other gene names :

Chrm1; Chrm1; Chrm-1

uniprot entry name :

ACM1_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

210-366

sequence length :

460

sequence :

RIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGA
EGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMES
LTSSEGEEPGSEVVIKMPMVDSEAQAPTKQPPKSSPNTV
KRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKEKKAAR
T

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

products references :

Identification of a family of muscarinic acetylcholine receptor genes.Bonner T.I., Buckley N.J., Young A.C., Brann M.R.Science 237:527-532(1987) The molecular properties of the M1 muscarinic receptor and its regulation of cytosolic calcium in a eukaryotic gene expression system.Lai J., Smith T.L., Mei L., Ikeda M., Fujiwara Y., Gomez J., Halonen M., Roeske W.R., Yamamura H.I.Adv. Exp. Med. Biol. 287:313-330(1991) Muscarinic acetylcholine receptors. Peptide sequencing identifies residues involved in antagonist binding and disulfide bond formation.Kurtenbach E., Curtis C.A.M., Pedder E.K., Aitken A., Harris A.C.M., Hulme E.C.J. Biol. Chem. 265:13702-13708(1990) Site-directed mutagenesis of the rat m1 muscarinic acetylcholine receptor. Role of conserved cysteines in receptor function.Savarese T.M., Wang C.-D., Fraser C.M.J. Biol. Chem. 267:11439-11448(1992)

ncbi gi num :

18249941

ncbi acc num :

NP_542951.1

ncbi gb acc num :

NM_080773.1

uniprot acc num :

P08482

ncbi mol weight :

21.2kD

ncbi pathways :

Amine Ligand-binding Receptors Pathway (1333943); Calcium Regulation In The Cardiac Cell Pathway (198495); Calcium Signaling Pathway (83442); Calcium Signaling Pathway (459); Cholinergic Synapse Pathway (217713); Class A/1 (Rhodopsin-like Receptors) Pathway (1333935); G Alpha (q) Signalling Events Pathway (1333968); GPCR Downstream Signaling Pathway (1333964); GPCR Ligand Binding Pathway (1333934); GPCRs, Class A Rhodopsin-like Pathway (198500)

ncbi summary :

plays a role in acetylcholine receptor signaling and neuromuscular synaptic transmission [RGD, Feb 2006]

uniprot summary :

mAChR m1: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM1 sub-subfamily. Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR. Cellular Component: asymmetric synapse; cell junction; dendrite; integral to plasma membrane; nerve terminal; plasma membrane; postsynaptic density; postsynaptic membrane; synapse. Molecular Function: drug binding; G-protein coupled acetylcholine receptor activity. Biological Process: acetylcholine receptor signaling, muscarinic pathway; cognition; muscarinic acetylcholine receptor, adenylate cyclase inhibiting pathway; muscarinic acetylcholine receptor, phospholipase C activating pathway; neuromuscular synaptic transmission; positive regulation of ion transport; regulation of locomotion; regulation of vascular smooth muscle contraction; saliva secretion; synaptic transmission, cholinergic

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage