Recombinant Human Calpain-1 catalytic subunit | MyBioSource MBS957983 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Calpain-1 catalytic subunit

catalog :

MBS957983

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS957983

products type :

Recombinant Protein

products full name :

Recombinant Human Calpain-1 catalytic subunit

products short name :

Calpain-1 catalytic subunit

products name syn :

Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP

other names :

calpain-1 catalytic subunit; Calpain-1 catalytic subunit; calpain-1 catalytic subunit; calpain 1; Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP

products gene name :

CAPN1

other gene names :

CAPN1; CAPN1; CANP; muCL; CANP1; CANPL1; muCANP; CANPL1; CANP 1; muCANP

uniprot entry name :

CAN1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-714

sequence length :

714

sequence :

MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLG
QDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSS
KTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWL
LAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQF
GEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAY
AKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL
YQIILKALERGSLLGCSIDIS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Biology

products description :

Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.

products references :

Complete amino acid sequence of the large subunit of the low-Ca2+-requiring form of human Ca2+-activated neutral protease (muCANP) deduced from its cDNA sequence.Aoki K., Imajoh S., Ohno S., Emori Y., Koike M., Kosaki G., Suzuki K.FEBS Lett. 205:313-317(1986) A novel member of the calcium-dependent cysteine protease family.Sorimachi H., Ohmi S., Emori Y., Kawasaki H., Saido T.C., Ohno S., Minami Y., Suzuki K.Biol. Chem. Hoppe-Seyler 371:171-176(1990) Identification of a human cell proliferation inducing gene.Kim J.W.NIEHS SNPs program Modulation of the calpain autoproteolysis by calpastatin and phospholipids.Melloni E., Michetti M., Salamino F., Minafra R., Pontremoli S.Biochem. Biophys. Res. Commun. 229:193-197(1996) Autolysis of human erythrocyte calpain produces two active enzyme forms with different cell localization.Michetti M., Salamino F., Tedesco I., Averna M., Minafra R., Melloni E., Pontremoli S.FEBS Lett. 392:11-15(1996) Calcium-binding properties of human erythrocyte calpain.Michetti M., Salamino F., Minafra R., Melloni E., Pontremoli S.Biochem. J. 325:721-726(1997) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Molecular mode of action of a covalently inhibiting peptidomimetic on the human calpain protease core.Li Q., Hanzlik R.P., Weaver R.F., Schonbrunn E.Biochemistry 45:701-708(2006)

ncbi gi num :

311893363

ncbi acc num :

NP_001185797.1

ncbi gb acc num :

NM_001198868.1

uniprot acc num :

P07384

ncbi mol weight :

85.9kD

ncbi pathways :

Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Alzheimers Disease Pathway (672448); Apoptosis Pathway (83060); Apoptosis Pathway (470); Degradation Of The Extracellular Matrix Pathway (1270257); Extracellular Matrix Organization Pathway (1270244); Focal Adhesion Pathway (198795); Integrated Pancreatic Cancer Pathway (711360); Integrin-mediated Cell Adhesion Pathway (198816)

ncbi summary :

The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

uniprot summary :

CAPN1: Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Forms a heterodimer with a small (regulatory) subunit (CAPNS1). Ubiquitous. Activated by micromolar concentrations of calcium and inhibited by calpastatin. Belongs to the peptidase C2 family. Protein type: Motility/polarity/chemotaxis; EC 3.4.22.52; Protease. Chromosomal Location of Human Ortholog: 11q13. Cellular Component: cytoplasm; cytosol; focal adhesion; lysosome; membrane; mitochondrion; plasma membrane. Molecular Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cytoskeletal protein binding; protein binding. Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; mammary gland involution; positive regulation of cell proliferation; proteolysis; receptor catabolic process

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1520

more info or order :

MyBioSource product webpage