product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Neuronal proto-oncogene tyrosine-protein kinase Src (Src)
catalog :
MBS957954
quantity :
1 mg (E Coli Derived
price :
2155 USD
more info or order :
product information
catalog number :
MBS957954
products type :
Recombinant Protein
products full name :
Recombinant Mouse Neuronal proto-oncogene tyrosine-protein kinase Src (Src)
products short name :
Neuronal proto-oncogene tyrosine-protein kinase Src (Src)
products name syn :
Recombinant Neuronal proto-oncogene tyrosine-protein kinase Src (Src); Neuronal proto-oncogene tyrosine-protein kinase Src EC= 2.7.10.2; Proto-oncogene c-Src pp60c-src; p60-Src
other names :
neuronal proto-oncogene tyrosine-protein kinase Src isoform 2; Neuronal proto-oncogene tyrosine-protein kinase Src; neuronal proto-oncogene tyrosine-protein kinase Src; p60-Src; proto-oncogene c-Src; Rous sarcoma oncogene; Proto-oncogene c-Src; pp60c-src
products gene name syn :
Src
other gene names :
Src; Src; AW259666; pp60c-src; p60-Src
uniprot entry name :
SRC_MOUSE
host :
E Coli or Yeast
sequence positions :
2-541
sequence length :
541
sequence :
GSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKP
ASADGHRGPSAAFVPPAAEPKLFGGFNSSDTVTSPQRAG
PLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRK
VDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWY
FGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSV
SDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLV
AYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRES
LRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPE
AFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKG
SLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYV
HRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGA
KFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRV
PYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWR
KEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
70794809
ncbi acc num :
NP_001020566.1
ncbi gb acc num :
NM_001025395.2
uniprot acc num :
P05480
ncbi mol weight :
60,645 Da
ncbi pathways :
ADP Signalling Through P2Y Purinoceptor 1 Pathway 639803!!Adaptive Immune System Pathway 640102!!Adherens Junction Pathway 83267!!Adherens Junction Pathway 481!!Alpha6-Beta4 Integrin Signaling Pathway 198373!!Androgen Receptor Signaling Pathway 198319!!Axon Guidance Pathway 640215!!Bacterial Invasion Of Epithelial Cells Pathway 149817!!Bacterial Invasion Of Epithelial Cells Pathway 148661!!CD28 Co-stimulation Pathway 640108
uniprot summary :
Function: Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protein-coupled receptors as well as cytokine receptors. Participates in signaling pathways that control a diverse spectrum of biological activities including gene transcription, immune response, cell adhesion, cell cycle progression, apoptosis, migration, and transformation. Due to functional redundancy between members of the SRC kinase family, identification of the specific role of each SRC kinase is very difficult. SRC appears to be one of the primary kinases activated following engagement of receptors and plays a role in the activation of other protein tyrosine kinase (PTK) families. Receptor clustering or dimerization leads to recruitment of SRC to the receptor complexes where it phosphorylates the tyrosine residues within the receptor cytoplasmic domains. Plays an important role in the regulation of cytoskeletal organization through phosphorylation of specific substrates such as AFAP1. Phosphorylation of AFAP1 allows the SRC SH2 domain to bind AFAP1 and to localize to actin filaments. Cytoskeletal reorganization is also controlled through the phosphorylation of cortactin (CTTN). When cells adhere via focal adhesions to the extracellular matrix, signals are transmitted by integrins into the cell resulting in tyrosine phosphorylation of a number of focal adhesion proteins, including PTK2/FAK1 and paxillin (PXN). In addition to phosphorylating focal adhesion proteins, SRC is also active at the sites of cell-cell contact adherens junctions and phosphorylates substrates such as beta-catenin (CTNNB1), delta-catenin (CTNND1), and plakoglobin (JUP). Another type of cell-cell junction, the gap junction, is also a target for SRC, which phosphorylates connexin-43 (GJA1). SRC is implicated in regulation of pre-mRNA-processing and phosphorylates RNA-binding proteins such as KHDRBS1. Also plays a role in PDGF-mediated tyrosine phosphorylation of both STAT1 and STAT3, leading to increased DNA binding activity of these transcription factors. Involved in the RAS pathway through phosphorylation of RASA1 and RASGRF1. Plays a role in EGF-mediated calcium-activated chloride channel activation. Required for epidermal growth factor receptor (EGFR) internalization through phosphorylation of clathrin heavy chain (CLTC and CLTCL1) at 'Tyr-1477'. Involved in beta-arrestin (ARRB1 and ARRB2) desensitization through phosphorylation and activation of ADRBK1, leading to beta-arrestin phosphorylation and internalization. Has a critical role in the stimulation of the CDK20/MAPK3 mitogen-activated protein kinase cascade by epidermal growth factor. Might be involved not only in mediating the transduction of mitogenic signals at the level of the plasma membrane but also in controlling progression through the cell cycle via interaction with regulatory proteins in the nucleus. Plays an important role in osteoclastic bone resorption in conjunction with PTK2B/PYK2. Both the formation of a SRC-PTK2B/PYK2 complex and SRC kinase activity are necessary for this function. Recruited to activated integrins by PTK2B/PYK2, thereby phosphorylating CBL, which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function. Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase. Phosphorylates DDR2 on tyrosine residues, thereby promoting its subsequent autophosphorylation. Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-731'. Enhances DDX58/RIG-I-elicited antiviral signaling.Phosphorylates PDPK1 at 'Tyr-9', 'Tyr-373' and 'Tyr-376' . By similarity. Ref.7 Ref.9 Ref.13 Ref.15. Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Enzyme regulation: Phosphorylation by CSK at Tyr-535 inhibits kinase activity. Inhibitory phosphorylation at Tyr-535 is enhanced by heme. Further phosphorylation by CDK1 partially reactivates CSK-inactivated SRC and facilitates complete reactivation by protein tyrosine phosphatase PTPRC. Integrin engagement stimulates kinase activity. Phosphorylation by PTK2/FAK1 enhances kinase activity. Butein and pseudosubstrate-based peptide inhibitors like CIYKYYF act as inhibitors. Phosphorylation at Tyr-424 increases kinase activity. Ref.8. Subunit structure: Interacts with CDCP1, PELP1, TGFB1I1 and TOM1L2 . By similarity. Interacts with DDEF1/ASAP1 via its SH3 domain. Interacts with CCPG1. Interacts with the cytoplasmic domain of MUC1, phosphorylates it and increases binding of MUC1 with beta-catenin. Interacts with RALGPS1 via its SH3 domain. Interacts with CAV2 (tyrosine phosphorylated form). Interacts (via the SH3 domain and the protein kinase domain) with ARRB1; the interaction is independent of the phosphorylation state of SRC C-terminus. Interacts with FCAMR and PXN. Interacts with ARRB2. Interacts with ARRB1. Interacts with SRCIN1 . By similarity. Interacts with SRCIN1. Interacts with NDFIP2 and more weakly with NDFIP1. Interacts with PIK3CA and/or PIK3C2B, PTK2/FAK1, ESR1 (dimethylated on arginine) and FAK. Interacts (via SH2 and SH3 domain) with TNK2. Interacts (via protein kinase domain) with the tyrosine phosphorylated form of RUNX3 (via runt domain). Interacts with TRAF3 (via RING-type zinc finger domain). Interacts with DDX58, MAVS and TBK1. Interacts (via SH2 domain) with GNB2L1/RACK1; the interaction is enhanced by tyrosine phosphorylation of GNB2L1 and inhibits SRC activity . By similarity. Interacts (via SH2 domain) with the 'Tyr-402' phosphorylated form of PTK2B/PYK2. Interacts (via SH2 domain) with FLT3 (tyrosine phosphorylated). Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN. Interacts with EPHB1; activates the MAPK/ERK cascade to regulate cell migration. Interacts with ERBB2 and STAT1. Interacts with PDGFRA (tyrosine phosphorylated). Interacts with CSF1R. Interacts (via SH2 domain) with the 'Tyr-9' phosphorylated form of PDPK1. Interacts with DDR2. Interacts with AMOTL2; this interaction regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Interacts with DDR1 and DAB2. Ref.5 Ref.6 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.21 Ref.22. Subcellular location: Cell membrane. Mitochondrion inner membrane. Nucleus. Cytoplasm cytoskeleton. Note: Localizes to focal adhesion sites after integrin engagement. Localization to focal adhesion sites requires myristoylation and the SH3 domain. Ref.13. Post-translational modification: Myristoylated at Gly-2, and this is essential for targeting to membranes . By similarity.Dephosphorylated at Tyr-535 by PTPRJ . By similarity. Phosphorylated on Tyr-535 by c-Src kinase (CSK). The phosphorylated form is termed pp60c-src. Dephosphorylated by PTPRJ at Tyr-424. Normally maintained in an inactive conformation with the SH2 domain engaged with Tyr-535, the SH3 domain engaged with the SH2-kinase linker, and Tyr-424 dephosphorylated. Dephosphorylation of Tyr-535 as a result of protein tyrosine phosphatase (PTP) action disrupts the intramolecular interaction between the SH2 domain and Tyr-535, Tyr-424 can then become autophosphorylated, resulting in SRC activation. Phosphorylation of Tyr-535 by CSK allows this interaction to reform, resulting in SRC inactivation. CDK5-mediated phosphorylation at Ser-74 targets SRC to ubiquitin-dependent degradation and thus leads to cytoskeletal reorganization. Phosphorylated by PTK2/FAK1; this enhances kinase activity. Phosphorylated by PTK2B/PYK2; this enhances kinase activity . By similarity.S-nitrosylation is important for activation of its kinase activity . By similarity.Ubiquitinated in response to CDK5-mediated phosphorylation. Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.Contains 1 protein kinase domain.Contains 1 SH2 domain.Contains 1 SH3 domain.
size :
1 mg (E Coli Derived)
price :
2155 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!