protein

Recombinant Human Alpha-synuclein protein

MBS957854

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Alpha-synuclein protein

Alpha-synuclein

Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

alpha-synuclein isoform NACP140; Alpha-synuclein; alpha-synuclein; synuclein alpha; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

SNCA

NACP; PAPK1

SNCA; SNCA; PD1; NACP; PARK1; PARK4; NACP; PARK1; NACP

SYUA_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-140

140

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMP
VDPDNEAYEMPSEEGYQDYEPEA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993)

4507109

NP_000336.1

NM_000345.3

P37840

18.6kD

Alpha-synuclein Signaling Pathway (137913); Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Alzheimers Disease Pathway (672448); Amyloid Fiber Formation Pathway (1269169); EGFR1 Signaling Pathway (198782); Metabolism Of Proteins Pathway (1268677); Parkin-Ubiquitin Proteasomal System Pathway (700638); Parkinson's Disease Pathway (83098); Parkinsons Disease Pathway (705377)

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq, Mar 2009]

SNCA: a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May integrate presynaptic signaling and membrane trafficking. Implicated in the pathogenesis of Parkinson's disease. A major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced isoforms transcripts have been identified. Protein type: Adaptor/scaffold. Chromosomal Location of Human Ortholog: 4q21. Cellular Component: actin cytoskeleton; axon; cell cortex; cell junction; cytoplasm; cytosol; extracellular region; extracellular space; fibril; Golgi apparatus; growth cone; inclusion body; lysosome; membrane; mitochondrial respiratory chain complex I; mitochondrion; nuclear outer membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; platelet alpha granule membrane; ribosome; rough endoplasmic reticulum; synaptic vesicle; terminal button. Molecular Function: alpha-tubulin binding; beta-tubulin binding; calcium ion binding; caspase inhibitor activity; copper ion binding; dynein binding; fatty acid binding; ferrous iron binding; histone binding; identical protein binding; kinesin binding; magnesium ion binding; microtubule binding; oxidoreductase activity; phospholipase binding; phospholipid binding; phosphoprotein binding; protein binding; protein domain specific binding; protein N-terminus binding; tau protein binding; zinc ion binding. Biological Process: adult locomotory behavior; aging; behavioral response to cocaine; calcium ion homeostasis; caspase activation; cellular protein metabolic process; dopamine biosynthetic process; dopamine uptake; fatty acid metabolic process; fibril organization and biogenesis; microglial cell activation; mitochondrial membrane organization and biogenesis; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of dopamine metabolic process; negative regulation of dopamine uptake; negative regulation of exocytosis; negative regulation of histone acetylation; negative regulation of microtubule polymerization; negative regulation of monooxygenase activity; negative regulation of neuron apoptosis; negative regulation of norepinephrine uptake; negative regulation of protein amino acid phosphorylation; negative regulation of serotonin uptake; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transporter activity; neutral lipid metabolic process; organelle ATP synthesis coupled electron transport; phospholipid metabolic process; positive regulation of apoptosis; positive regulation of endocytosis; positive regulation of neurotransmitter secretion; positive regulation of peptidyl-serine phosphorylation; positive regulation of receptor recycling; positive regulation of release of sequestered calcium ion into cytosol; protein destabilization; receptor internalization; regulation of acyl-CoA biosynthetic process; regulation of dopamine secretion; regulation of excitatory postsynaptic membrane potential; regulation of glutamate secretion; regulation of locomotion; regulation of long-term neuronal synaptic plasticity; regulation of macrophage activation; response to drug; response to iron(II) ion; response to lipopolysaccharide; response to magnesium ion; synapse organization and biogenesis; synaptic vesicle endocytosis. Disease: Dementia, Lewy Body; Parkinson Disease 1, Autosomal Dominant; Parkinson Disease 4, Autosomal Dominant

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750