Recombinant Human Cathepsin K | MyBioSource MBS957808 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Cathepsin K

catalog :

MBS957808

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS957808

products type :

Recombinant Protein

products full name :

Recombinant Human Cathepsin K

products short name :

Cathepsin K

products name syn :

Cathepsin O; Cathepsin O2; Cathepsin X

other names :

cathepsin K preproprotein; Cathepsin K; cathepsin K; cathepsin K; Cathepsin O; Cathepsin O2; Cathepsin X

products gene name :

CTSK

products gene name syn :

CTSO; CTSO2

other gene names :

CTSK; CTSK; CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2; CTSO; CTSO2

uniprot entry name :

CATK_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

115-329

sequence length :

329

sequence :

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLK
KKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKN
RGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGN
EKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCN
SDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYIL
MARNKNNACGIANLASFPKM

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.

products references :

Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.Shi G.-P., Chapman H.A., Bhairi S.M., Deleeuw C., Reddy V.Y., Weiss S.J.FEBS Lett. 357:129-134(1995) Molecular cloning of human cDNA for cathepsin K novel cysteine proteinase predominantly expressed in bone.Inaoka T., Bilbe G., Ishibashi O., Tezuka K., Kumegawa M., Kokubo T.Biochem. Biophys. Res. Commun. 206:89-96(1995) Cloning and complete coding sequence of a novel human cathepsin expressed in giant cells of osteoclastomas.Li Y., Alexander M., Wucherpfennig A.L., Yelick P., Chen W., Stashenko P.J. Bone Miner. Res. 10:1197-1202(1995) Human cathepsin O2, a novel cysteine protease highly expressed in osteoclastomas and ovary molecular cloning, sequencing and tissue distribution.Broemme D., Okamoto K.Biol. Chem. Hoppe-Seyler 376:379-384(1995) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Crystal structure of human cathepsin K complexed with a potent inhibitor.McGrath M.E., Klaus J.L., Barnes M.G., Bromme D.Nat. Struct. Biol. 4:105-109(1997) Design of potent and selective human cathepsin K inhibitors that span the active site.Thompson S.K., Halbert S.M., Bossard M.J., Tomaszek T.A., Levy M.A., Zhao B., Smith W.W., Abdel-Meguid S.S., Janson C.A., D'Alessio K.J., McQueney M.S., Amegadzie B.Y., Hanning C.R., Desjarlais R.L., Briand J., Sarkar S.K., Huddleston M.J., Ijames C.F., Carr S.A., Garnes K.T., Shu A., Heys J.R., Bradbeer J., Zembryki D., Veber D.F.Proc. Natl. Acad. Sci. U.S.A. 94:14249-14254(1997) The crystal structure of human procathepsin K.LaLonde J.M., Zhao B., Janson C.A., D'Alessio K.J., McQueney M.S., Orsini M.J., Debouck C.M., Smith W.W.Biochemistry 38:862-869(1999) Crystal structure of wild-type human procathepsin K.Sivaraman J., Lalumiere M., Menard R., Cygler M.Protein Sci. 8:283-290(1999) Pycnodysostosis, a lysosomal disease caused by cathepsin K deficiency.Gelb B.D., Shi G.-P., Chapman H.A., Desnick R.J.Science 273:1236-1238(1996) Paternal uniparental disomy for chromosome 1 revealed by molecular analysis of a patient with pycnodysostosis.Gelb B.D., Willner J.P., Dunn T.M., Kardon N.B., Verloes A., Poncin J., Desnick R.J.Am. J. Hum. Genet. 62:848-854(1998) Mutations of CTSK result in pycnodysostosis via a reduction in cathepsin K protein.Ho N., Punturieri A., Wilkin D., Szabo J., Johnson M., Whaley J., Davis J., Clark A., Weiss S., Francomano C.J. Bone Miner. Res. 14:1649-1653(1999) Cathepsin K gene mutations and 1q21 haplotypes in at patients with pycnodysostosis in an outbred population.Haagerup A., Hertz J.M., Christensen M.F., Binderup H., Kruse T.A.Eur. J. Hum. Genet. 8:431-436(2000)

ncbi gi num :

4503151

ncbi acc num :

NP_000387.1

ncbi gb acc num :

NM_000396.3

uniprot acc num :

P43235

ncbi mol weight :

25.5kD

ncbi pathways :

Activation Of Matrix Metalloproteinases Pathway (1270258); Adaptive Immune System Pathway (1269171); Collagen Degradation Pathway (1270259); Degradation Of The Extracellular Matrix Pathway (1270257); Extracellular Matrix Organization Pathway (1270244); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); Lysosome Pathway (99052); Lysosome Pathway (96865); MHC Class II Antigen Presentation Pathway (1269200)

ncbi summary :

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. [provided by RefSeq, Apr 2013]

uniprot summary :

CTSK: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Defects in CTSK are the cause of pycnodysostosis (PKND). PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature. Belongs to the peptidase C1 family. Protein type: EC 3.4.22.38; Protease. Chromosomal Location of Human Ortholog: 1q21. Cellular Component: extracellular region; extracellular space; lysosome. Molecular Function: collagen binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity; fibronectin binding; protein binding; proteoglycan binding. Biological Process: bone resorption; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; innate immune response; intramembranous ossification; proteolysis; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway. Disease: Pycnodysostosis

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

965

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage