catalog number :
MBS957676
products type :
Recombinant Protein
products full name :
Recombinant Human Transcription activator BRG1
products short name :
Transcription activator BRG1
other names :
transcription activator BRG1 isoform B; Transcription activator BRG1; transcription activator BRG1; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; ATP-dependent helicase SMARCA4; BRG1-associated factor 190A; BAF190A; Mitotic growth and transcription activator; Protein BRG-1; Protein brahma homolog 1; SNF2-beta; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
products gene name :
SMARCA4
other gene names :
SMARCA4; SMARCA4; BRG1; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A; BAF190A; BRG1; SNF2B; SNF2L4; BAF190A
uniprot entry name :
SMCA4_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
700-1246
sequence :
EVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAV
TERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGIL
ADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLS
NWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNV
LLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLT
QVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIF
KSCSTFEQWFNAPFAMTGEKV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cancer
ncbi acc num :
NP_001122316.1
ncbi gb acc num :
NM_001128844.1
ncbi mol weight :
64.83kD
ncbi pathways :
Chromatin Modifying Enzymes Pathway (1270434); Chromatin Organization Pathway (1270433); Direct P53 Effectors Pathway (137939); Formation Of The Beta-catenin:TCF Transactivating Complex Pathway (1269602); Glucocorticoid Receptor Regulatory Network Pathway (138014); Integrated Breast Cancer Pathway (219801); Prostate Cancer Pathway (755440); RMTs Methylate Histone Arginines Pathway (1270439); Regulation Of Wnt-mediated Beta Catenin Signaling And Target Gene Transcription Pathway (169352); Regulation Of Retinoblastoma Protein Pathway (137916)
ncbi summary :
The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
uniprot summary :
SMARCA4: a member of the SWI/SNF nucleosome remodeling complex with ATP-dependent DNA helicase activity. SWI/SNF complexes are required for mammalian development and are mutated in ~20% of all human primary tumors. Mutated in 35% (13/37) of NSCLC and 5% (1/19) of SCLC human lung cancer cell lines . A component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. Belongs to the neural progenitor-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). Component of the BAF53 complex which acetylates histone H4 and H2A within nucleosomes. Transcriptional coactivator of nuclear hormone receptors. Acts as a corepressor of ZEB1 to regulate E-cadherin transcription, and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1. Can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. SMARCA4, in consort with ZEB1, represses the transcription of E-cadherin and promotes the epithelial-to-mesenchymal transisition (EMT). SMARCA4 is required for stem cell maintenance in the mouse intestinal epithelium. Its loss inhibits aberrant Wnt-signalling and prevents tumorigenesis in the mouse small intestine. SMARCA4 mutations are the cause of a familial cancer syndrome predisposing to renal or extrarenal malignant rhabdoid tumors and to a variety of tumors of the central nervous system, including choroid plexus carcinoma, medulloblastoma, and central primitive neuroectodermal tumors. Rhabdoid tumors are the most aggressive and lethal malignancies occurring in early childhood. Belongs to the SNF2/RAD54 helicase family. The human protein includes 5 isoforms produced by alternative splicing. Protein type: EC 3.6.1.-; Nuclear receptor co-regulator; EC 3.6.4.-; Transcription, coactivator/corepressor; Helicase; Tumor suppressor; Cell cycle regulation. Chromosomal Location of Human Ortholog: 19p13.2. Cellular Component: extracellular space; membrane; nuclear chromatin; nucleolus; nucleoplasm; nucleus; protein complex; SWI/SNF complex. Molecular Function: androgen receptor binding; ATP binding; DNA-dependent ATPase activity; helicase activity; nucleosomal DNA binding; p53 binding; protein binding; protein N-terminus binding; Tat protein binding; transcription coactivator activity; transcription corepressor activity; transcription factor binding. Biological Process: ATP-dependent chromatin remodeling; chromatin remodeling; establishment and/or maintenance of chromatin architecture; negative regulation of cell growth; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter, mitotic; negative regulation of transcription, DNA-dependent; nervous system development; nucleosome disassembly; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of Wnt receptor signaling pathway; regulation of transcription from RNA polymerase II promoter; spermatid development; transcription, DNA-dependent. Disease: Mental Retardation, Autosomal Dominant 16; Rhabdoid Tumor Predisposition Syndrome 2