product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Receptor-type tyrosine-protein phosphatase N2
catalog :
MBS957675
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS957675
products type :
Recombinant Protein
products full name :
Recombinant Mouse Receptor-type tyrosine-protein phosphatase N2
products short name :
Receptor-type tyrosine-protein phosphatase N2
products name syn :
PTP IA-2beta; Protein tyrosine phosphatase-NP; PTP-NP
other names :
receptor-type tyrosine-protein phosphatase N2; Receptor-type tyrosine-protein phosphatase N2; receptor-type tyrosine-protein phosphatase N2; protein tyrosine phosphatase, receptor type, N polypeptide 2; PTP IA-2beta
products gene name :
Ptprn2
other gene names :
Ptprn2; Ptprn2; Phol; PTP-NP; IA2beta; phogrin; mKIAA0387; 4930425H11Rik; PTP-NP
uniprot entry name :
PTPR2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
28-600
sequence length :
1001
sequence :
RGRQLPGRLGCLFEDGLCGSLETCVNDGVFGRCQKVPVM
DTYRYEVPPGALLHLKVTLQKLSRTGFTWQDDYTQRVIA
QELANLPKAYLWHGEASGPARSLQQNADNEKWFSLEREV
ALAKTLRRYLPYLELLSQTPTANAHSRIDHETRPAKGED
SSPENILTYVAHTSALTYPPATRAKYPDNLLRPFSRLQP
DELSPKVDGDIDKQKLIAALGAYTAQRLPGENDPEPRYL
VHGSARAPRPFSATALSQRWP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Implicated in development of nervous system and pancreatic endocrine cells.
products references :
PTP-NP, a new member of the receptor protein tyrosine phosphatase family, implicated in development of nervous system and pancreatic endocrine cells.Chiang M.-K., Flanagan J.G.Development 122:2239-2250(1996) Identification of a second transmembrane protein tyrosine phosphatase, IA-2beta, as an autoantigen in insulin-dependent diabetes mellitus precursor of the 37-kDa tryptic fragment.Lu J., Li Q., Xie H., Chen Z.-J., Borovitskaya A.E., Maclaren N.K., Notkins A.L., Lan M.S.Proc. Natl. Acad. Sci. U.S.A. 93:2307-2311(1996) Targeted disruption of the IA-2beta gene causes glucose intolerance and impairs insulin secretion but does not prevent the development of diabetes in NOD mice.Kubosaki A., Gross S., Miura J., Saeki K., Zhu M., Nakamura S., Hendriks W., Notkins A.L.Diabetes 53:1684-1691(2004)
ncbi gi num :
226052731
ncbi acc num :
NP_035345.2
ncbi gb acc num :
NM_011215.2
uniprot acc num :
P80560
ncbi mol weight :
65.66kD
ncbi pathways :
Type I Diabetes Mellitus Pathway (83292); Type I Diabetes Mellitus Pathway (507)
uniprot summary :
PTPRN2: Implicated in development of nervous system and pancreatic endocrine cells. Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; EC 3.1.3.48; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine. Cellular Component: cell junction; cytoplasm; cytoplasmic vesicle; endoplasmic reticulum lumen; integral to membrane; membrane; receptor complex; secretory granule; secretory granule membrane; synapse; synaptic vesicle membrane; terminal button. Molecular Function: hydrolase activity; phosphoprotein phosphatase activity; phosphoric monoester hydrolase activity; protein binding; protein tyrosine phosphatase activity. Biological Process: dephosphorylation; protein amino acid dephosphorylation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1370
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!