product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human T-cell receptor alpha chain C region
catalog :
MBS957674
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS957674
products type :
Recombinant Protein
products full name :
Recombinant Human T-cell receptor alpha chain C region
products short name :
T-cell receptor alpha chain C region
other names :
T-cell receptor alpha chain C region; T-cell receptor alpha chain C region; T-cell receptor alpha constant
products gene name :
TRAC
other gene names :
TRAC; TRAC; TRA; IMD7; TCRA; TRCA; TCRA
uniprot entry name :
TCA_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-142
sequence length :
142
sequence :
PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAF
NNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS
VIGFRILLLKVAGFNLLMTLRLWSS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products references :
The chromosomal location of T-cell receptor genes and a T cell rearranging gene possible correlation with specific translocations in human T cell leukaemia.Rabbitts T.H., Lefranc M.P., Stinson M.A., Sims J.E., Schroder J., Steinmetz M., Spurr N.L., Solomon E., Goodfellow P.N.EMBO J. 4:1461-1465(1985) Analysis of cDNA clones specific for human T cells and the alpha and beta chains of the T-cell receptor heterodimer from a human T-cell line.Yanagi Y., Chan A., Chin B., Minden M., Mak T.W.Proc. Natl. Acad. Sci. U.S.A. 82:3430-3434(1985) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) Mutation in the TCRalpha subunit constant gene (TRAC) leads to a human immunodeficiency disorder characterized by a lack of TCRalphabeta+ T cells.Morgan N.V., Goddard S., Cardno T.S., McDonald D., Rahman F., Barge D., Ciupek A., Straatman-Iwanowska A., Pasha S., Guckian M., Anderson G., Huissoon A., Cant A., Tate W.P., Hambleton S., Maher E.R.J. Clin. Invest. 121:695-702(2011) The 1.5 A crystal structure of a highly selected antiviral T cell receptor provides evidence for a structural basis of immunodominance.Kjer-Nielsen L., Clements C.S., Brooks A.G., Purcell A.W., McCluskey J., Rossjohn J.Structure 10:1521-1532(2002) A structural basis for immunodominant human T cell receptor recognition.Stewart-Jones G.B.E., McMichael A.J., Bell J.I., Stuart D.I., Jones E.Y.Nat. Immunol. 4:657-663(2003) Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.Li Y., Huang Y., Lue J., Quandt J.A., Martin R., Mariuzza R.A.EMBO J. 24:2968-2979(2005)
ncbi gi num :
135511
ncbi acc num :
P01848.1
uniprot acc num :
P01848
ncbi mol weight :
20kD
ncbi pathways :
Adaptive Immune System Pathway (1269171); Costimulation By The CD28 Family Pathway (1269177); Downstream TCR Signaling Pathway (1269176); Generation Of Second Messenger Molecules Pathway (1269175); Immune System Pathway (1269170); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (1269201); PD-1 Signaling Pathway (1269182); Phosphorylation Of CD3 And TCR Zeta Chains Pathway (1269173); TCR Signaling Pathway (1269172); Translocation Of ZAP-70 To Immunological Synapse Pathway (1269174)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!