Recombinant Human Cancer/testis antigen 1 | MyBioSource MBS957660 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Cancer/testis antigen 1

catalog :

MBS957660

quantity :

0.05 mg (Yeast)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS957660

products type :

Recombinant Protein

products full name :

Recombinant Human Cancer/testis antigen 1

products short name :

Cancer/testis antigen 1

products name syn :

Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer/testis antigen 6.1; CT6.1L antigen family member 2; LAGE-2

other names :

cancer/testis antigen 1; Cancer/testis antigen 1; cancer/testis antigen 1; cancer/testis antigen 1B; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer/testis antigen 6.1; CT6.1; L antigen family member 2; LAGE-2

products gene name :

CTAG1A

other gene names :

CTAG1B; CTAG1A; CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1; CTAG; CTAG1; ESO1; LAGE2; LAGE2A; CT6.1; LAGE-2

uniprot entry name :

CTG1B_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-180

sequence length :

180

sequence :

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGA
TGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRC
GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLP
VPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQL
SLLMWITQCFLPVFLAQPPSGQRR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cancer

products references :

A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening.Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J.Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997) LAGE-1, a new gene with tumor specificity.Lethe B.G., Lucas S., Michaux L., De Smet C., Godelaine D., Serrano A., De Plaen E., Boon T.3.0.CO;2-1>Int. J. Cancer 76:903-908(1998) A breast and melanoma-shared tumor antigen T cell responses to antigenic peptides translated from different open reading frames.Wang R.-F., Johnston S.L., Zeng G., Topalian S.L., Schwartzentruber D.J., Rosenberg S.A.J. Immunol. 161:3598-3606(1998) DNA methylation is the primary silencing mechanism for a set of germ line- and tumor-specific genes with a CpG-rich promoter.De Smet C., Lurquin C., Lethe B.G., Martelange V., Boon T.Mol. Cell. Biol. 19:7327-7335(1999) Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes.Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L.Hum. Mol. Genet. 10:2557-2567(2001) The DNA sequence of the human X chromosome.Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C., Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.Nature 434:325-337(2005)

ncbi gi num :

4503119

ncbi acc num :

NP_001318.1

ncbi gb acc num :

NM_001327.2

uniprot acc num :

P78358

ncbi mol weight :

20kD

ncbi summary :

The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]

uniprot summary :

CTAG1B: is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]. Protein type: Cancer Testis Antigen (CTA). Chromosomal Location of Human Ortholog: Xq28. Cellular Component: cytoplasm. Molecular Function: protein binding

size1 :

0.05 mg (Yeast)

price1 :

185 USD

size2 :

0.2 mg (Yeast)

price2 :

420

size3 :

0.5 mg (Yeast)

price3 :

680

size4 :

1 mg (Yeast)

price4 :

1070

more info or order :

MyBioSource product webpage