catalog number :
MBS957638
products type :
Recombinant Protein
products full name :
Recombinant Pig Calpain-2 catalytic subunit
products short name :
Calpain-2 catalytic subunit
products name syn :
Calcium-activated neutral proteinase 2; CANP 2; Calpain M-type; Calpain-2 large subunit; Millimolar-calpain; M-calpain
other names :
Calpain-2 catalytic subunit; Calpain-2 catalytic subunit; calpain-2 catalytic subunit; Calcium-activated neutral proteinase 2; CANP 2; Calpain M-type; Calpain-2 large subunit; Millimolar-calpain; M-calpain
products gene name :
CAPN2
other gene names :
CAPN2; CAPN2; CANP 2; M-calpain
uniprot entry name :
CAN2_PIG
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-324
sequence :
YPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKH
RRRQRKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFL
THRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNK
DGDFCIRVFSEKKADYQVVDDEIEADLEENDASEDDIDD
GFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDG
FSIETCRIMVDMLDSDGSAKLGLKEFYILWTKIQKYQKI
YREIDVDRSGTMNSYEMRKAL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226'.
products references :
Cloning the partial cDNAs of mu-calpain and m-calpain from porcine skeletal muscle.Sun W., Ji S.Q., Ebert P.J., Bidwell C.A., Hancock D.L.Biochimie 75:931-936(1993)
Hypoxia-specific upregulation of calpain activity and gene expression in pulmonary artery endothelial cells.Zhang J.L., Patel J.M., Block E.R.Am. J. Physiol. 275:L461-L468(1998)
ncbi pathways :
Alzheimer's Disease Pathway (84508); Alzheimer's Disease Pathway (509); Apoptosis Pathway (84472); Apoptosis Pathway (470); Focal Adhesion Pathway (84479); Focal Adhesion Pathway (478); Protein Processing In Endoplasmic Reticulum Pathway (167312); Protein Processing In Endoplasmic Reticulum Pathway (167190)
size4 :
0.05 mg (Baculovirus)