protein

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

MBS957394

0.01 mg (E-Coli)

200 USD

Recombinant Protein

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

[Cytotoxic T-lymphocyte protein 4 (Ctla4)]

[Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD_antigen=; CD152]

[cytotoxic T-lymphocyte protein 4 isoform 1; Cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD_antigen: CD152]

[Ctla4]

[Ctla4; Cd152]

[Ctla4; Ctla4; Cd152; Ly-56; Ctla-4; Cd152; CTLA-4]

CTLA4_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

[36-161aa; Extracellular Domain]

161

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVL
RQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVN
LTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVI
DPEPCPDSD

>=90%

Liquid containing glycerol

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Species: Mus musculus (Mouse)

Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

Immunology

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28

31981847

NP_033973.2

NM_009843.4

P09793

24,993 Da

Adaptive Immunity Signaling Pathway (366714); Autoimmune Thyroid Disease Pathway (83314); Autoimmune Thyroid Disease Pathway (533); CTLA4 Inhibitory Signaling Pathway (366724); Cell Adhesion Molecules (CAMs) Pathway (83266); Cell Adhesion Molecules (CAMs) Pathway (480); Costimulation By The CD28 Family Pathway (366720); Immune System Pathway (366713); Rheumatoid Arthritis Pathway (200310); Rheumatoid Arthritis Pathway (200269)

This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2013]

CTLA-4: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism. Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12). A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3). It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Immunoglobulin superfamily. Cellular Component: Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane; integral to membrane; clathrin-coated endocytic vesicle; external side of plasma membrane. Biological Process: B cell receptor signaling pathway; negative regulation of T cell proliferation; immune system process; negative regulation of regulatory T cell differentiation; positive regulation of apoptosis; negative regulation of immune response; immune response; negative regulation of B cell proliferation; response to DNA damage stimulus

0.01 mg (E-Coli)

200 USD

0.05 mg (E-Coli)

260

0.1 mg (E-Coli)

430

0.2 mg (E-Coli)

685

0.5 mg (E-Coli)

1125

1 mg (E-Coli)

1725