product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB)
catalog :
MBS957392
quantity :
0.05 mg (E-Coli)
price :
610 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS957392
products type :
Recombinant Protein
products full name :
Recombinant Human ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB)
products short name :
[ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB)]
other names :
[ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase peripheral stalk-membrane subunit b; ATP synthase proton-transporting mitochondrial F(0) complex subunit B1; ATP synthase subunit b; ATPase subunit b]
products gene name :
[ATP5PB]
other gene names :
[ATP5PB; ATP5F1; PIG47; ATP5F1; ATPase subunit b]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[43-256aa. Full Length of Mature Protein]
sequence :
PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGT
GLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQAL
VQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLD
YHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIA
KCIADLKLLAKKAQAQPVM
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products description :
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
ncbi gi num :
21361565
ncbi acc num :
NP_001679.2
ncbi gb acc num :
NM_001688.4
uniprot acc num :
P24539
ncbi mol weight :
28,909 Da
ncbi pathways :
Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Electron Transport Chain Pathway (198860); F-type ATPase, Eukaryotes Pathway (522535); F-type ATPase, Eukaryotes Pathway (890450); Formation Of ATP By Chemiosmotic Coupling Pathway (105922); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolic Pathways (132956); Metabolism Pathway (477135)
ncbi summary :
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq, Jul 2008]
uniprot summary :
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
size1 :
0.05 mg (E-Coli)
price1 :
610 USD
size2 :
0.05 mg (Yeast)
price2 :
760
size3 :
0.2 mg (E-Coli)
price3 :
825
size4 :
0.5 mg (E-Coli)
price4 :
910
size5 :
0.05 mg (Baculovirus)
price5 :
980
size6 :
0.2 mg (Yeast)
price6 :
1020
size7 :
0.5 mg (Yeast)
price7 :
1155
size8 :
0.05 mg (Mammalian-Cell)
price8 :
1215
size9 :
1 mg (E-Coli)
price9 :
1360
size10 :
0.1 mg (Baculovirus)
price10 :
1405
size11 :
1 mg (Yeast)
price11 :
1820
size12 :
0.5 mg (Baculovirus)
price12 :
1835
size13 :
0.1 mg (Mammalian-Cell)
price13 :
1980
size14 :
1 mg (Baculovirus)
price14 :
2855
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!