protein

Recombinant Human Tubulin beta-3 chain protein

MBS957354

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Tubulin beta-3 chain protein

Tubulin beta-3 chain

Tubulin beta-4 chain; Tubulin beta-III

tubulin beta-3 chain isoform 2; Tubulin beta-3 chain; tubulin beta-3 chain; tubulin beta 3 class III; Tubulin beta-4 chain; Tubulin beta-III

TUBB3

TUBB3; TUBB3; CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; TUBB4

TBB3_HUMAN

E Coli

1-210; Partial.

210

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGD
SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRS
GAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVL
DVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVR
EEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVEN
TDETYCIDNEALYDI

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.

Cloning and sequencing of human betaIII-tubulin cDNA induction of betaIII isotype in human prostate carcinoma cells by acute exposure to antimicrotubule agents.Ranganathan S., Dexter D.W., Benetatos C.A., Hudes G.R.Biochim. Biophys. Acta 1395:237-245(1998) Banerjee A. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Lubec G., Afjehi-Sadat L., Chen W.-Q., Sun Y.Submitted (DEC-2008) to UniProtKB Class III beta-tubulin isotype a key cytoskeletal protein at the crossroads of developmental neurobiology and tumor neuropathology.Katsetos C.D., Legido A., Perentes E., Mork S.J.J. Child Neurol. 18:851-866(2003) ErratumKatsetos C.D., Legido A., Perentes E., Mork S.J.J. Child Neurol. 19:531-531(2004) Microtubule regulation in mitosis tubulin phosphorylation by the cyclin-dependent kinase Cdk1.Fourest-Lieuvin A., Peris L., Gache V., Garcia-Saez I., Juillan-Binard C., Lantez V., Job D.Mol. Biol. Cell 17:1041-1050(2006) Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.J. Proteome Res. 7:5167-5176(2008) Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.Rogowski K., Juge F., van Dijk J., Wloga D., Strub J.-M., Levilliers N., Thomas D., Bre M.-H., Van Dorsselaer A., Gaertig J., Janke C.Cell 137:1076-1087(2009) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Human TUBB3 mutations perturb microtubule dynamics, kinesin interactions, and axon guidance.Tischfield M.A., Baris H.N., Wu C., Rudolph G., Van Maldergem L., He W., Chan W.M., Andrews C., Demer J.L., Robertson R.L., Mackey D.A., Ruddle J.B., Bird T.D., Gottlob I., Pieh C., Traboulsi E.I., Pomeroy S.L., Hunter D.G., Soul J.S., Newlin A., Sabol L.J., Doherty E.J., de Uzcategui C.E., de Uzcategui N., Collins M.L., Sener E.C., Wabbels B., Hellebrand H., Meitinger T., de Berardinis T., Magli A., Schiavi C., Pastore-Trossello M., Koc F., Wong A.M., Levin A.V., Geraghty M.T., Descartes M., Flaherty M., Jamieson R.V., Moller H.U., Meuthen I., Callen D.F., Kerwin J., Lindsay S., Meindl A., Gupta M.L. Jr., Pellman D., Engle E.C.Cell 140:74-87(2010) Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.Leandro-Garcia L.J., Leskela S., Landa I., Montero-Conde C., Lopez-Jimenez E., Leton R., Cascon A., Robledo M., Rodriguez-Antona C.Cytoskeleton 67:214-223(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Mutations in the neuronal ss-tubulin subunit TUBB3 result in malformation of cortical development and neuronal migration defects.Poirier K., Saillour Y., Bahi-Buisson N., Jaglin X.H., Fallet-Bianco C., Nabbout R., Castelnau-Ptakhine L., Roubertie A., Attie-Bitach T., Desguerre I., Genevieve D., Barnerias C., Keren B., Lebrun N., Boddaert N., Encha-Razavi F., Chelly J.Hum. Mol. Genet. 19:4462-4473(2010)

308235963

NP_001184110.1

NM_001197181.1

Q13509

50.5kD

Chaperonin-mediated Protein Folding Pathway (1268694); Cooperation Of Prefoldin And TriC/CCT In Actin And Tubulin Folding Pathway (1268695); Diurnally Regulated Genes With Circadian Orthologs Pathway (198813); Formation Of Tubulin Folding Intermediates By CCT/TriC Pathway (1268697); Gap Junction Pathway (83072); Gap Junction Pathway (483); Metabolism Of Proteins Pathway (1268677); Parkin-Ubiquitin Proteasomal System Pathway (700638); Pathogenic Escherichia Coli Infection Pathway (83103); Pathogenic Escherichia Coli Infection Pathway (672459)

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010]

TUBB3: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. TUBB3 plays a critical role in proper axon guidance and mantainance. Dimer of alpha and beta chains. Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues. Belongs to the tubulin family. Protein type: Motility/polarity/chemotaxis; Cytoskeletal. Chromosomal Location of Human Ortholog: 16q24.3. Cellular Component: axon; cell soma; cytoplasm; dendrite; microtubule; nucleus. Molecular Function: GTP binding; GTPase activity; peptide binding; protein binding; structural constituent of cytoskeleton. Biological Process: 'de novo' posttranslational protein folding; axon guidance; cellular protein metabolic process; microtubule-based process; mitosis; protein folding. Disease: Cortical Dysplasia, Complex, With Other Brain Malformations 1; Fibrosis Of Extraocular Muscles, Congenital, 3a, With Or Without Extraocular Involvement

0.05 mg (E-Coli)

180 USD

0.2 mg (E-Coli)

490

0.5 mg (E-Coli)

715

1 mg (E-Coli)

1170