product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Excitatory amino acid transporter 2 (Slc1a2)
catalog :
MBS957295
quantity :
1 mg (E Coli Derived
price :
1135 USD
more info or order :
product information
catalog number :
MBS957295
products type :
Recombinant Protein
products full name :
Recombinant Rat Excitatory amino acid transporter 2 (Slc1a2)
products short name :
Excitatory amino acid transporter 2 (Slc1a2)
products name syn :
Recombinant Excitatory amino acid transporter 2 (Slc1a2); Excitatory amino acid transporter 2; GLT-1 Sodium-dependent glutamate/aspartate transporter 2; GLUT-R Solute carrier family 1 member 2
other names :
excitatory amino acid transporter 2 isoform a; Excitatory amino acid transporter 2; excitatory amino acid transporter 2; high affinity glucose transporter; sodium-dependent glutamate/aspartate transporter 2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2
products gene name syn :
Slc1a2; Eaat2, Glt1
other gene names :
Slc1a2; Slc1a2; Glt; Eaat2; Glt-1; Eaat2; Glt1; GLUT-R
uniprot entry name :
EAA2_RAT
host :
E Coli or Yeast
sequence positions :
143-238
sequence length :
573
sequence :
HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLV
QACFQQIQTVTKKVLVAPPSEEANTTKAVISLLNETMNE
APEETKIVIKKGLEFKDG
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
78126167
ncbi acc num :
NP_058911.2
ncbi gb acc num :
NM_017215.2
uniprot acc num :
P31596
ncbi mol weight :
62,106 Da
ncbi pathways :
Amyotrophic Lateral Sclerosis (ALS) Pathway 83491!!Amyotrophic Lateral Sclerosis (ALS) Pathway 511!!Astrocytic Glutamate-Glutamine Uptake And Metabolism Pathway 649014!!Glutamatergic Synapse Pathway 213815!!Glutamatergic Synapse Pathway 213811!!Neuronal System Pathway 648992!!Neurotransmitter Uptake And Metabolism In Glial Cells Pathway 649013!!SLC-mediated Transmembrane Transport Pathway 649828!!Transmembrane Transport Of Small Molecules Pathway 649824!!Transmission Across Chemical Synapses Pathway 648995
ncbi summary :
mediates dihydrokainate-sensitive glutamate transport; may play a role in presynaptic terminal glutamate transport and synaptic transmission [RGD, Feb 2006]
uniprot summary :
Function: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Subunit structure: Homotrimer . By similarity. Interacts with AJUBA. Ref.8. Subcellular location: Membrane; Multi-pass membrane protein. Tissue specificity: Localized in brain and is highly enriched in the Purkinje cell layer in cerebellum. Post-translational modification: Glycosylated.Palmitoylation at Cys-38 is not required for correct subcellular localization, but is important for glutamate uptake activity . By similarity. Sequence similarities: Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A2 subfamily. [View classification]. Sequence caution: The sequence AAA93062.1 differs from that shown. Reason: Erroneous initiation.
size :
1 mg (E Coli Derived)
price :
1135 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!