product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial
catalog :
MBS957283
quantity :
0.01 mg (E-Coli)
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS957283
products type :
Recombinant Protein
products full name :
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial
products short name :
[Asialoglycoprotein receptor 2 (Asgr2)]
other names :
[asialoglycoprotein receptor 2 isoform a; Asialoglycoprotein receptor 2; asialoglycoprotein receptor 2; asialoglycoprotein receptor 2; Hepatic lectin 2; HL-2; mHL-2]
products gene name :
[Asgr2]
other gene names :
[Asgr2; Asgr2; Asgr; HL-2; ASGPR2; Asgr-2; Asgr-2; ASGP-R 2; ASGPR 2; HL-2; mHL-2]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[80-301. Partial, provide the complete extracellular domain.]
sequence :
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNA
ILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTC
QLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQ
YCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDG
SWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEI
LSDGHWNDNFCQQVNRWVCEKRRNITH
purity :
Greater than 85% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products categories :
Signal Transduction
products description :
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
products references :
Mouse asialoglycoprotein receptor cDNA sequence: conservation of receptor genes during mammalian evolution." Sanford J.P., Doyle D. Biochim. Biophys. Acta 1087:259-261(1990)
ncbi gi num :
927227642
ncbi acc num :
NP_001300854.1
ncbi gb acc num :
NM_001313925.1
uniprot acc num :
P24721
ncbi mol weight :
29.9 kDa
ncbi pathways :
Thyroid Hormone Synthesis Pathway (835432); Thyroid Hormone Synthesis Pathway (839541)
ncbi summary :
This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene [provided by RefSeq, Sep 2015]
uniprot summary :
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
size1 :
0.01 mg (E-Coli)
price1 :
200 USD
size2 :
0.05 mg (E-Coli)
price2 :
260
size3 :
0.1 mg (E-Coli)
price3 :
430
size4 :
0.2 mg (E-Coli)
price4 :
685
size5 :
0.05 mg (Yeast)
price5 :
770
size6 :
0.05 mg (Baculovirus)
price6 :
985
size7 :
0.2 mg (Yeast)
price7 :
1030
size8 :
0.5 mg (E-Coli)
price8 :
1125
size9 :
0.5 mg (Yeast)
price9 :
1165
size10 :
0.05 mg (Mammalian-Cell)
price10 :
1220
size11 :
0.1 mg (Baculovirus)
price11 :
1415
size12 :
0.1 mg (Mammalian-Cell)
price12 :
1425
size13 :
1 mg (E-Coli)
price13 :
1725
size14 :
1 mg (Yeast)
price14 :
1840
size15 :
0.5 mg (Baculovirus)
price15 :
1850
size16 :
1 mg (Baculovirus)
price16 :
2875
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!