protein

Recombinant Mouse Asialoglycoprotein receptor 1

MBS957253

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Mouse Asialoglycoprotein receptor 1

Asialoglycoprotein receptor 1

Hepatic lectin 1; HL-1; mHL-1

Asialoglycoprotein receptor 1; asialoglycoprotein receptor 1; asialoglycoprotein receptor 1; Hepatic lectin 1; HL-1; mHL-1

Asgr1

Asgr1; Asgr1; Asgr; HL-1; ASGPR1; Asgr-1; Asgr-1; ASGP-R 1; ASGPR 1; HL-1; mHL-1

ASGR1_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

61-284

284

QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGR
KMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSC
QMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEA
DKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQ
NGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCA
HFTTDGRWNDDVCRRPYRWVCETKLDKAN

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Determination of mouse major asialoglycoprotein receptor cDNA sequence.Takezawa R., Shinzawa K., Watanabe Y., Akaike T.Biochim. Biophys. Acta 1172:220-222(1993) The major form of the murine asialoglycoprotein receptor cDNA sequence and expression in liver, testis and epididymis.Monroe R.S., Huber B.E.Gene 148:237-244(1994) Organization of the mouse ASGR1 gene encoding the major subunit of the hepatic asialoglycoprotein receptor.Soukharev S., Berlin W., Hanover J.A., Bethke B., Sauer B.Gene 241:233-240(2000) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.

NP_001278060.1

P34927

53.2kD

Thyroid Hormone Synthesis Pathway (835432); Thyroid Hormone Synthesis Pathway (839541)

ASGR1: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Protein type: Membrane protein, integral. Cellular Component: integral to membrane; membrane. Molecular Function: asialoglycoprotein receptor activity; carbohydrate binding; metal ion binding; protein homodimerization activity. Biological Process: cellular response to extracellular stimulus; endocytosis; receptor-mediated endocytosis

INQUIRE

INQUIRE