protein

Recombinant Human Transcriptional regulator ERG

MBS957095

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Transcriptional regulator ERG

Transcriptional regulator ERG

Transforming protein ERG

transcriptional regulator ERG isoform 3; Transcriptional regulator ERG; transcriptional regulator ERG; v-ets avian erythroblastosis virus E26 oncogene homolog; Transforming protein ERG

ERG

ERG; ERG; p55; erg-3

ERG_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-486

486

MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTE
MTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECN
PSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEE
KHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKE
YGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADIL
LSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGA
AFIFPNTSVYPEATQRITTRP

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transcription

Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

erg, a human ets-related gene on chromosome 21 alternative splicing, polyadenylation, and translation.Rao V.N., Papas T.S., Shyam E., Reddy P.Science 237:635-639(1987) The erg gene a human gene related to the ets oncogene.Reddy E.S.P., Rao V.N., Papas T.S.Proc. Natl. Acad. Sci. U.S.A. 84:6131-6135(1987) Detailed mapping of the ERG-ETS2 interval of human chromosome 21 and comparison with the region of conserved synteny on mouse chromosome 16.Owczarek C.M., Portbury K.J., Hardy M.P., O'Leary D.A., Kudoh J., Shibuya K., Shimizu N., Kola I., Hertzog P.J.Gene 324:65-77(2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Differentially spliced erg-3 product functions as a transcriptional activator.Prasad D.D., Rao V.N., Lee L., Reddy E.S.Oncogene 9:669-673(1994) ERG gene is translocated in an Ewing's sarcoma cell line.Dunn T., Praissman L., Hagag N., Viola M.V.Cancer Genet. Cytogenet. 76:19-22(1994) An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation.Ichikawa H., Shimizu K., Hayashi Y., Ohki M.Cancer Res. 54:2865-2868(1994) ELF4 is fused to ERG in a case of acute myeloid leukemia with a t(X;21) (q25-26;q22) .Moore S.D., Offor O., Ferry J.A., Amrein P.C., Morton C.C., Dal Cin P.Leuk. Res. 30:1037-1042(2006) Molecular composition of IMP1 ribonucleoprotein granules.Joeson L., Vikesaa J., Krogh A., Nielsen L.K., Hansen T., Borup R., Johnsen A.H., Christiansen J., Nielsen F.C.Mol. Cell. Proteomics 6:798-811(2007) Diversity in structure and function of the Ets family PNT domains.Mackereth C.D., Scharpf M., Gentile L.N., MacIntosh S.E., Slupsky C.M., McIntosh L.P.J. Mol. Biol. 342:1249-1264(2004)

209954797

NP_001129626.1

NM_001136154.1

P11308

70.6kD

Prostate Cancer Pathway (755440); Transcriptional Misregulation In Cancer Pathway (523016); Transcriptional Misregulation In Cancer Pathway (522987)

This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014]

ERG: Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure. Defects in ERG are a cause of Ewing sarcoma (ES). A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. A chromosomal aberration involving ERG is found in patients with Erwing sarcoma. Translocation t(21;22)(q22;q12) with EWSR1. Chromosomal aberrations involving ERG have been found in acute myeloid leukemia (AML). Translocation t(16;21)(p11;q22) with FUS. Translocation t(X;21)(q25-26;q22) with ELF4. Belongs to the ETS family. 6 isoforms of the human protein are produced by alternative splicing. Protein type: Oncoprotein; DNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 21q22.3. Cellular Component: cytoplasm; nucleus; ribonucleoprotein complex. Molecular Function: chromatin binding; DNA binding; protein binding; sequence-specific DNA binding; signal transducer activity. Biological Process: cell differentiation; cell migration; cell proliferation; multicellular organismal development; protein amino acid phosphorylation; regulation of transcription from RNA polymerase II promoter; signal transduction; transcription, DNA-dependent

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750