protein

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6)

MBS957029

0.01 mg (E-Coli)

200 USD

Recombinant Protein

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6)

[Nuclear receptor subfamily 2 group F member 6 (NR2F6)]

[V-erbA-related protein 2; EAR-2]

[nuclear receptor subfamily 2 group F member 6; Nuclear receptor subfamily 2 group F member 6; nuclear receptor subfamily 2 group F member 6; nuclear receptor subfamily 2 group F member 6; V-erbA-related protein 2; EAR-2]

[NR2F6]

[NR2F6; NR2F6; EAR2; EAR-2; ERBAL2; EAR2; ERBAL2; EAR-2]

NR2F6_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

[1-404aa; Full Length]

404

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAA
SDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKS
FFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCF
RVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVAS
GGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGA
VLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVAL
LRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAE
RAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFT
PDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFG
RLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDML
LSGSTFNWPYGSGQ

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Species: Homo sapiens (Human). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

Epigenetics and Nuclear Signaling

Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).

Identification of two novel members of erbA superfamily by molecular cloning: the gene products of the two are highly related to each other." Miyajima N., Kadowaki Y., Fukushige S., Shimizu S., Semba K., Yamanashi Y., Matsubara K., Toyoshima K., Yamamoto T. Nucleic Acids Res. 16:11057-11074(1988)

20070199

NP_005225.2

NM_005234.3

P10588

58.95kD

Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Nuclear Receptor Transcription Pathway (1269652); Nuclear Receptors Pathway (198848)

EAR-2: Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type- specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC). Belongs to the nuclear hormone receptor family. NR2 subfamily. Protein type: Nuclear receptor; DNA-binding. Chromosomal Location of Human Ortholog: 19p13.1. Cellular Component: nucleoplasm; nucleus. Molecular Function: DNA binding; ligand-dependent nuclear receptor activity; protein binding; sequence-specific DNA binding; steroid hormone receptor activity; thyroid hormone receptor activity; transcription factor activity; zinc ion binding. Biological Process: detection of temperature stimulus involved in sensory perception of pain; entrainment of circadian clock by photoperiod; gene expression; intracellular receptor-mediated signaling pathway; negative regulation of transcription from RNA polymerase II promoter; neuron development; signal transduction; steroid hormone mediated signaling; transcription initiation from RNA polymerase II promoter

0.01 mg (E-Coli)

200 USD

0.05 mg (E-Coli)

260

0.1 mg (E-Coli)

430

0.2 mg (E-Coli)

685

0.5 mg (E-Coli)

1125

1 mg (E-Coli)

1725