Recombinant Dog Transforming growth factor beta-1 (TGFB1) | MyBioSource MBS956970 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Dog Transforming growth factor beta-1 (TGFB1)

catalog :

MBS956970

quantity :

0.05 mg (E-Coli)

price :

505 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS956970

products type :

Recombinant Protein

products full name :

Recombinant Dog Transforming growth factor beta-1 (TGFB1)

products short name :

[Transforming growth factor beta-1 (TGFB1)]

products name syn :

[Recombinant Transforming growth factor beta-1 (TGFB1); Transforming growth factor beta-1; TGF-beta-1 Cleaved into the following chain: 1. Latency-associated peptide; 2. LAP]

other names :

[transforming growth factor beta-1; Transforming growth factor beta-1; transforming growth factor beta-1; TGF-beta-1; transforming growth factor beta 1; transforming growth factor-beta 1; transforming growth factor, beta 1 (Camurati-Engelmann disease)]

products gene name syn :

[TGFB1]

other gene names :

[TGFB1; TGFB1; TGF-beta-1; LAP]

uniprot entry name :

TGFB1_CANFA

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[279-390. Partial,provide Transforming growth factor beta-1 chain]

sequence :

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGY
HANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCC
VPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

purity :

>=90%(SDS-PAGE)

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

image1 heading :

SDS-PAGE

other info1 :

Species: Canis familiaris (Dog) (Canis lupus familiaris)

products description :

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts .

ncbi gi num :

50979134

ncbi acc num :

NP_001003309.1

ncbi gb acc num :

NM_001003309.1

uniprot acc num :

P54831

ncbi mol weight :

17kD

ncbi pathways :

Amoebiasis Pathway (167342); Amoebiasis Pathway (167191); Cell Cycle Pathway (84104); Cell Cycle Pathway (463); Chagas Disease (American Trypanosomiasis) Pathway (147812); Chagas Disease (American Trypanosomiasis) Pathway (147795); Chronic Myeloid Leukemia Pathway (84162); Chronic Myeloid Leukemia Pathway (528); Colorectal Cancer Pathway (84152); Colorectal Cancer Pathway (518)

uniprot summary :

Function: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts . By similarity. Subunit structure: Homodimer; disulfide-linked, or heterodimer with TGFB2 . By similarity. Secreted and stored as a biologically inactive form in the extracellular matrix in a 290 kDa complex (large latent TGF-beta1 complex) containing the TGFB1 homodimer, the latency-associated peptide (LAP), and the latent TGFB1 binding protein-1 (LTBP1). The complex without LTBP1 is known as the'small latent TGF-beta1 complex'. Dissociation of the TGFB1 from LAP is required for growth factor activation and biological activity. Release of the large latent TGF-beta1 complex from the extracellular matrix is carried out by the matrix metalloproteinase MMP3 . By similarity. Interacts with CD109 and DPT. Interacts with ASPN. May interact with THSD4; this interaction may lead to sequestration by FBN1 microfibril assembly and attenuation of TGFB signaling. Interacts with the serine proteases, HTRA1 and HTRA3: the interaction with either inhibits TGFB1-mediated signaling. The HTRA protease activity is required for this inhibition . By similarity. Subcellular location: Secreted extracellular space extracellular matrix . By similarity. Domain: The 'straitjacket' and 'arm' domains encircle the growth factor monomers and are fastened together by strong bonding between Lys-56 and Tyr-103/Tyr-104. Activation of TGF-beta1 requires the binding of integrin alpha-V to an RGD sequence in the prodomain and exertion of force on this domain, which is held in the extracellular matrix by latent TGF-beta binding proteins. The sheer physical force unfastens the straitjacket and releases the active growth factor dimer . By similarity. Post-translational modification: Glycosylated . By similarity.The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive . By similarity. Sequence similarities: Belongs to the TGF-beta family.

size1 :

0.05 mg (E-Coli)

price1 :

505 USD

size2 :

0.2 mg (E-Coli)

price2 :

675

size3 :

0.05 mg (Yeast)

price3 :

675

size4 :

0.5 mg (E-Coli)

price4 :

745

size5 :

0.05 mg (Baculovirus)

price5 :

895

size6 :

0.2 mg (Yeast)

price6 :

910

size7 :

0.5 mg (Yeast)

price7 :

1025

size8 :

1 mg (E-Coli)

price8 :

1110

size9 :

0.05 mg (Mammalian-Cell)

price9 :

1130

size10 :

0.1 mg (Baculovirus)

price10 :

1280

size11 :

1 mg (Yeast)

price11 :

1610

size12 :

0.5 mg (Baculovirus)

price12 :

1680

size13 :

0.1 mg (Mammalian-Cell)

price13 :

1845

size14 :

1 mg (Baculovirus)

price14 :

2625

more info or order :

MyBioSource product webpage