protein

Recombinant Mouse DNA-dependent protein kinase catalytic subunit

MBS956945

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Mouse DNA-dependent protein kinase catalytic subunit

DNA-dependent protein kinase catalytic subunit

p460

DNA-dependent protein kinase catalytic subunit; DNA-dependent protein kinase catalytic subunit; DNA-dependent protein kinase catalytic subunit; protein kinase, DNA activated, catalytic polypeptide; p460

PRKDC

HYRC; HYRC1

Prkdc; Prkdc; p460; scid; slip; DNAPK; DNPK1; HYRC1; XRCC7; dxnph; DOXNPH; DNAPDcs; AI326420; AU019811; DNA-PKcs; Xrcc7; DNA-PK catalytic subunit; DNA-PKcs

PRKDC_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

3747-4015

4128

EYPFLVKGGEDLRQDQRIEQIFEVMNAILSQDAACSQRN
MQLRTYRVVPMTSRLGLIEWIENTMTLKDLLLSNMSQEE
KVANNSDPKAPIRDYKDWLMKVSGKSDAGAYVLMYSRAN
RTETVVAFRRRESQVPPDLLKRAFVKMSTSPEAFLALRS
HFASSHALLCISHWLLGIGDRHLNNFMVAMETGSVIGID
FGHAFGSATQFLPVPELMPFRLTRQFVSLMLPMKETGLM
CTVMVHALRAFRSCAGLLTDT

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, C1D, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect machanism.

Nonsense mutation at Tyr-4046 in the DNA-dependent protein kinase catalytic subunit of severe combined immune deficiency mice.Araki R., Fujimori A., Hamatani K., Mita K., Saito T., Mori M., Fukumura R., Morimyo M., Muto M., Itoh M., Tatsumi K., Abe M.Proc. Natl. Acad. Sci. U.S.A. 94:2438-2443(1997) Murine cell line SX9 bearing a mutation in the DNA-PKcs gene exhibits aberrant V(D) J recombination not only in the coding joint but also in the signal joint.Fukumura R., Araki R., Fujimori A., Mori M., Saito T., Watanabe F., Sarashi M., Itsukaichi H., Eguch-Kasai K., Sato K., Tatsumi K., Abe M.J. Biol. Chem. 273:13058-13064(1998) The murine DNA-PKcs gene consists of 86 exons dispersed in more than 250 kb.Fujimori A., Araki R., Fukumura R., Saito T., Mori M., Mita K., Tatsumi K., Abe M.Genomics 45:194-199(1997) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mouse Cdc21 only 0.5 kb upstream from DNA-PKcs in a head-to-head organization an implication of co-evolution of ATM family members and cell cycle regulating genes.Saito T., Matsuda Y., Ishii H., Watanabe F., Mori M., Hayashi A., Araki R., Fujimori A., Fukumura R., Morimyo M., Tatsumi K., Hori T., Abe M.Mamm. Genome 9:769-772(1998) Nonhomologous end-joining deficiency of L5178Y-S cells is not associated with mutation in the ABCDE autophosphorylation cluster.Brzoska K., Kruszewski M., Szumiel I.Acta Biochim. Pol. 53:233-236(2006) Cloning and chromosomal mapping of the mouse DNA-dependent protein kinase gene.Hamatani K., Matsuda Y., Araki R., Itoh M., Abe M.Immunogenetics 45:1-5(1996) Identification of a nonsense mutation in the carboxyl-terminal region of DNA-dependent protein kinase catalytic subunit in the scid mouse.Blunt T., Gell D., Fox M., Taccioli G.E., Lehmann A.R., Jackson S.P., Jeggo P.A.Proc. Natl. Acad. Sci. U.S.A. 93:10285-10290(1996) Biochemical and genetic defects in the DNA-dependent protein kinase in murine scid lymphocytes.Danska J.S., Holland D.P., Mariathasan S., Williams K.M., Guidos C.J.Mol. Cell. Biol. 16:5507-5517(1996) Functional interaction between DNA-PK and c-Abl in response to DNA damage.Kharbanda S., Pandey P., Jin S., Inoue S., Bharti A., Yuan Z.-M., Weichselbaum R., Weaver D., Kufe D.Nature 386:732-735(1997) Functional interaction between DNA-PKcs and telomerase in telomere length maintenance.Espejel S., Franco S., Sgura A., Gae D., Bailey S.M., Taccioli G.E., Blasco M.A.EMBO J. 21:6275-6287(2002) GAPDH mediates nitrosylation of nuclear proteins.Kornberg M.D., Sen N., Hara M.R., Juluri K.R., Nguyen J.V., Snowman A.M., Law L., Hester L.D., Snyder S.H.Nat. Cell Biol. 12:1094-1100(2010) Phosphorylation of the cryptochrome 1 C-terminal tail regulates circadian period length.Gao P., Yoo S.H., Lee K.J., Rosensweig C., Takahashi J.S., Chen B.P., Green C.B.J. Biol. Chem. 288:35277-35286(2013)

124517706

NP_035289.2

NM_011159.2

P97313

34.7kD

Cell Cycle Pathway (83251); Cell Cycle Pathway (198407); Cell Cycle Pathway (463); Cell Cycle Signaling Pathway (522974); Cytosolic Sensors Of Pathogen-associated DNA Pathway (1323730); DNA Double-Strand Break Repair Pathway (1324071); DNA Repair Pathway (1324048); DNA-PK Complex Pathway (421826); DNA-PK Complex Pathway (890556); FAS Pathway And Stress Induction Of HSP Regulation (198421)

DNAPK: an atypical protein kinase of the PIKK family. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. and modulation of transcription. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Defects cause severe combined immune deficiency (SCID) which is characterized by a lack of mature functional lymphocytes and a high susceptibility to lethal opportunistic infections. Required for repair of radiation-induced dsDNA breaks. Loss of function in mice or horses leads to the SCID (severe combined immune deficiency) phenotype due to failure of immunoglobulin rearrangement. Target of mutation in mismatch repair-deficient colorectal cancer. Inhibitor: KU-7059. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Nucleolus; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; EC 2.7.11.1; DNA repair, damage; ATYPICAL group; PIKK family; DNAPK subfamily. Cellular Component: DNA-dependent protein kinase complex; membrane; nuclear chromosome, telomeric region; nucleoplasm; nucleus; transcription factor complex. Molecular Function: ATP binding; DNA binding; DNA-dependent protein kinase activity; double-stranded DNA binding; enzyme binding; kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor; protein binding; protein kinase activity; protein serine/threonine kinase activity; transcription factor binding; transferase activity. Biological Process: B cell lineage commitment; brain development; cell proliferation; cellular response to insulin stimulus; DNA damage response, signal transduction resulting in induction of apoptosis; DNA repair; double-strand break repair; double-strand break repair via nonhomologous end joining; germ cell programmed cell death; heart development; immunoglobulin production; immunoglobulin V(D)J recombination; lymphocyte differentiation; negative regulation of apoptosis; negative regulation of immunoglobulin production; negative regulation of protein amino acid phosphorylation; peptidyl-serine phosphorylation; phosphorylation; positive regulation of apoptosis; positive regulation of developmental growth; positive regulation of fibroblast proliferation; positive regulation of immune system process; positive regulation of transcription from RNA polymerase II promoter; pro-B cell differentiation; protein destabilization; regulation of circadian rhythm; regulation of smooth muscle cell proliferation; response to DNA damage stimulus; response to gamma radiation; response to ionizing radiation; rhythmic process; somitogenesis; spleen development; T cell differentiation in the thymus; T cell lineage commitment; T cell receptor V(D)J recombination; telomere capping; telomere maintenance; thymus development; V(D)J recombination

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070