Recombinant Human Perforin-1 | MyBioSource MBS956765 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Perforin-1

catalog :

MBS956765

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS956765

products type :

Recombinant Protein

products full name :

Recombinant Human Perforin-1

products short name :

Perforin-1

products name syn :

Cytolysin; Lymphocyte pore-forming protein; PFP

other names :

perforin-1; Perforin-1; perforin-1; perforin 1; Cytolysin; Lymphocyte pore-forming protein; PFP

products gene name :

PRF1

other gene names :

PRF1; PRF1; P1; PFP; FLH2; PFN1; HPLH2; PFP; P1; PFP

uniprot entry name :

PERF_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

22-555, Mature full length protein.

sequence length :

555

sequence :

PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQG
SGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPK
PTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECR
FYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLI
SNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVE
DCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQ
TYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLP
GSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRA
RWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQ
RGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRT
STVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGR
DDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPH
LGGGTCLDYVPQMLLGEPPGNRSGAVW

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e. g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.

products references :

Structure and function of human perforin.Lichtenheld M.G., Olsen K.J., Lu P., Lowrey D.M., Hameed A., Hengartner H., Podack E.R.Nature 335:448-451(1988) Molecular cloning and chromosomal assignment of a human perforin (PFP) gene.Shinkai Y., Yoshida C.M., Maeda K., Kobata T., Maruyama K., Yodoi J., Yagita H., Okumura K.Immunogenetics 30:452-457(1989) Structure of the human perforin gene. A simple gene organization with interesting potential regulatory sequences.Lichtenheld M.G., Podack E.R.J. Immunol. 143:4267-4274(1989) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)

ncbi gi num :

133908621

ncbi acc num :

NP_001076585.1

ncbi gb acc num :

NM_001083116.1

uniprot acc num :

P14222

ncbi mol weight :

75.1kD

ncbi pathways :

Allograft Rejection Pathway (920963); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Apoptosis Pathway (198797); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Caspase Cascade In Apoptosis Pathway (137974); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Graft-versus-host Disease Pathway (83124); Graft-versus-host Disease Pathway (536)

ncbi summary :

The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

uniprot summary :

PRF1: Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. Monomer, as sobluble protein. Homooligomer. Oligomerization is required for pore formation. Repressed by contact with target cells. Belongs to the complement C6/C7/C8/C9 family. Protein type: Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 10q22. Cellular Component: cytoplasmic membrane-bound vesicle; extracellular region; integral to membrane; membrane; plasma membrane. Molecular Function: calcium ion binding; protein binding; wide pore channel activity. Biological Process: apoptosis; cellular defense response; cytolysis; defense response to tumor cell; defense response to virus; formation of immunological synapse; immune response to tumor cell; protein homooligomerization; transmembrane transport. Disease: Aplastic Anemia; Hemophagocytic Lymphohistiocytosis, Familial, 2; Lymphoma, Non-hodgkin, Familial

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (Baculovirus)

price4 :

950

size5 :

0.05 mg (Baculovirus)

price5 :

950

more info or order :

MyBioSource product webpage