product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Interleukin-2 receptor subunit beta
catalog :
MBS956731
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS956731
products type :
Recombinant Protein
products full name :
Recombinant Mouse Interleukin-2 receptor subunit beta
products short name :
Interleukin-2
products name syn :
High affinity IL-2 receptor subunit beta; p70-75; CD122
other names :
interleukin-2 receptor subunit beta; Interleukin-2 receptor subunit beta; interleukin-2 receptor subunit beta; interleukin 2 receptor, beta chain; High affinity IL-2 receptor subunit beta; p70-75; CD_antigen: CD122
products gene name :
l2rb
other gene names :
Il2rb; Il2rb; p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB
uniprot entry name :
IL2RB_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-240
sequence length :
539
sequence :
ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVH
AKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTS
VDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQ
VLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSW
EDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNT
GTWSPWSQPLTFRTRPADPMKE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
products references :
Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810(1990)
ncbi gi num :
6680427
ncbi acc num :
NP_032394.1
ncbi gb acc num :
NM_008368.4
uniprot acc num :
P16297
ncbi mol weight :
29.4kD
ncbi pathways :
ARMS-mediated Activation Pathway (1324638); Axon Guidance Pathway (1323598); Cytokine Signaling In Immune System Pathway (1323763); Cytokine-cytokine Receptor Interaction Pathway (83248); Cytokine-cytokine Receptor Interaction Pathway (460); DAP12 Interactions Pathway (1323743); DAP12 Signaling Pathway (1323744); Developmental Biology Pathway (1323597); Downstream Signal Transduction Pathway (1324645); Downstream Signaling Of Activated FGFR1 Pathway (1324563)
ncbi summary :
The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors. [provided by RefSeq, Jul 2008]
uniprot summary :
IL2RB: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Non-covalent dimer of an alpha and a beta subunit. IL2R exists in 3 different forms: a high affinity dimer, an intermediate affinity monomer (beta subunit), and a low affinity monomer (alpha subunit). The high and intermediate affinity forms also associate with a gamma subunit. Interacts with SHB upon interleukin stimulation. Interacts with HTLV-1 accessory protein p12I. Belongs to the type I cytokine receptor family. Type 4 subfamily. Protein type: Receptor, cytokine; Membrane protein, integral. Cellular Component: cell surface; external side of plasma membrane; integral to membrane; membrane. Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-2 binding; interleukin-2 receptor activity. Biological Process: cytokine and chemokine mediated signaling pathway; natural killer cell activation; negative regulation of apoptosis
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!