Recombinant Human Oxytocin-neurophysin 1 (OXT) | MyBioSource MBS956725 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Oxytocin-neurophysin 1 (OXT)

catalog :

MBS956725

quantity :

0.01 mg (E-Coli)

price :

175 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS956725

products type :

Recombinant Protein

products full name :

Recombinant Human Oxytocin-neurophysin 1 (OXT)

products short name :

[Oxytocin-neurophysin 1 (OXT)]

products name syn :

[Oxytocin-neurophysin 1; OT-NPICleaved into the following 2 chains:; 1. Oxytocin; Ocytocin; Neurophysin 1]

other names :

[oxytocin-neurophysin 1 preproprotein; Oxytocin-neurophysin 1; oxytocin-neurophysin 1; neurophysin I; oxytocin, prepropeptide; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein; oxytocin/neurophysin I prepropeptide; Ocytocin]

products gene name :

[OXT]

products gene name syn :

[OXT; OT]

other gene names :

[OXT; OXT; OT; OT-NPI; OXT-NPI; OT; OT-NPI]

uniprot entry name :

NEU1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[32-125aa; Partial]

sequence length :

125

sequence :

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTA
EALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDG
CHADPACDAEATFSQR

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-Page

other info1 :

Species: Homo sapiens (Human)

other info2 :

Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products description :

Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.

ncbi gi num :

4505537

ncbi acc num :

NP_000906.1

ncbi gb acc num :

NM_000915.3

uniprot acc num :

P01178

ncbi mol weight :

12,722 Da

ncbi pathways :

Class A/1 (Rhodopsin-like Receptors) Pathway (106357); G Alpha (q) Signalling Events Pathway (106043); GPCR Downstream Signaling Pathway (119548); GPCR Ligand Binding Pathway (161020); Gastrin-CREB Signalling Pathway Via PKC And MAPK (645295); Myometrial Relaxation And Contraction Pathways (198759); Peptide Ligand-binding Receptors Pathway (106358); Signal Transduction Pathway (477114); Signaling By GPCR Pathway (106356); Vasopressin-like Receptors Pathway (106361)

ncbi summary :

This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. [provided by RefSeq, Dec 2013]

uniprot summary :

OXT: Neurophysin 1 specifically binds oxytocin. Belongs to the vasopressin/oxytocin family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 20p13. Cellular Component: extracellular space; extracellular region; terminal button; secretory granule. Molecular Function: oxytocin receptor binding; neurohypophyseal hormone activity. Biological Process: response to peptide hormone stimulus; response to cAMP; male mating behavior; heart development; response to glucocorticoid stimulus; drinking behavior; positive regulation of female receptivity; female pregnancy; signal transduction; positive regulation of synaptic transmission; response to estradiol stimulus; elevation of cytosolic calcium ion concentration; hyperosmotic salinity response; negative regulation of blood pressure; response to electrical stimulus; response to food; grooming behavior; response to retinoic acid; maternal behavior; regulation of heart rate; eating behavior; response to amphetamine; social behavior; response to ether; sleep; response to cocaine; positive regulation of ossification; memory; response to sucrose stimulus; positive regulation of synaptogenesis; positive regulation of prostaglandin secretion; response to activity; regulation of sensory perception of pain; sperm ejaculation; response to progesterone stimulus; positive regulation of blood pressure

size1 :

0.01 mg (E-Coli)

price1 :

175 USD

size2 :

0.05 mg (E-Coli)

price2 :

225

size3 :

0.01 mg (Yeast)

price3 :

230

size4 :

0.05 mg (Yeast)

price4 :

305

size5 :

0.1 mg (E-Coli)

price5 :

360

size6 :

0.1 mg (Yeast)

price6 :

510

size7 :

0.2 mg (E-Coli)

price7 :

575

size8 :

0.2 mg (Yeast)

price8 :

815

size9 :

0.5 mg (E-Coli)

price9 :

945

size10 :

0.5 mg (Yeast)

price10 :

1345

size11 :

1 mg (E-Coli)

price11 :

1445

size12 :

1 mg (Yeast)

price12 :

2065

more info or order :

MyBioSource product webpage