product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Translationally-controlled tumor protein
catalog :
MBS956588
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS956588
products type :
Recombinant Protein
products full name :
Recombinant Mouse Translationally-controlled tumor protein
products short name :
Translationally-controlled tumor
products name syn :
21 kDa polypeptide; p21; p23
other names :
translationally-controlled tumor protein; Translationally-controlled tumor protein; translationally-controlled tumor protein; tumor protein, translationally-controlled 1; 21 kDa polypeptide; p21; p23
products gene name :
Tpt1
products gene name syn :
Trt
other gene names :
Tpt1; Tpt1; Trt; p21; p23; TCTP; Trt; TCTP
uniprot entry name :
TCTP_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-172
sequence length :
172
sequence :
MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRT
EGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHL
QETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTG
AAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGV
TPFMIFFKDGLEMEKC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Involved in calcium binding and microtubule stabilization.
products references :
Nucleotide sequence of a major messenger RNA for a 21 kilodalton polypeptide that is under translational control in mouse tumor cells.Makrides S., Chitpatima S.T., Bandyopadhyay R., Brawerman G.Nucleic Acids Res. 16:2350-2350(1988) The growth-related protein P23 of the Ehrlich ascites tumor translational control, cloning and primary structure.Boehm H., Beendorf R., Gaestel M., Gross B., Nuernberg P., Kraft R., Otto A., Bielka H.Biochem. Int. 19:277-286(1989) Genomic organization and expression of mouse Tpt1 gene.Fiucci G., Lespagnol A., Stumptner-Cuvelette P., Beaucourt S., Duflaut D., Susini L., Amson R., Telerman A.Genomics 81:570-578(2003) Lubec G., Klug S., Yang J.W., Zigmond M.Submitted (JUL-2007) to UniProtKB
ncbi gi num :
6678437
ncbi acc num :
NP_033455.1
ncbi gb acc num :
NM_009429.3
uniprot acc num :
P63028
ncbi mol weight :
23.5kD
uniprot summary :
TPT1: a novel heat shock protein with antiapoptotic and chaperone-like activity. Its levels are highly regulated in response to various cellular stimuli and stresses. Downregulated in response to proapoptotic treatments that induce Ca(++) stress, in a PKR-dependent manner. Colocalizes with CHFR to the mitotic spindle. Appears to be involved in calcium binding and microtubule stabilization. Its exosomal secretion is induced following DNA damage. Interacts with MCL1 and STEAP3, a p53-inducible transmembrane protein that facilitates the exosomal secretion of TPT1. Secreted TPT1 acts as a histamine-releasing factor, participates in inflammatory responses by inducing the release of histamine, and may play a role in tumor reversion. May play a direct role in placental calcium transport. Phosphorylation by Plk may decrease its microtubule-stabilizing activity and promote microtubule dynamics following metaphase. Critical for peripheral T cell maintenance and TCR-mediated cell proliferation. Protein type: Microtubule-binding; Calcium-binding. Cellular Component: cytoplasm; extracellular space; multivesicular body; nucleoplasm; nucleus; tubulin complex. Molecular Function: calcium ion binding; protein binding; transcription factor binding. Biological Process: stem cell maintenance
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!