Recombinant Human Thyroid hormone receptor beta | MyBioSource MBS956532 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Thyroid hormone receptor beta

catalog :

MBS956532

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS956532

products type :

Recombinant Protein

products full name :

Recombinant Human Thyroid hormone receptor beta

products short name :

Thyroid hormone receptor beta

products name syn :

Nuclear receptor subfamily 1 group A member 2; c-erbA-2c-erbA-beta

other names :

thyroid hormone receptor beta; Thyroid hormone receptor beta; thyroid hormone receptor, beta; Nuclear receptor subfamily 1 group A member 2; c-erbA-2; c-erbA-beta

products gene name :

THRB

products gene name syn :

ERBA2; NR1A2; THR1

other gene names :

THRB; THRB; GRTH; PRTH; THR1; ERBA2; NR1A2; THRB1; THRB2; C-ERBA-2; C-ERBA-BETA; ERBA2; NR1A2; THR1

uniprot entry name :

THB_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-461

sequence length :

461

sequence :

MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHR
KSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQ
SVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGY
HYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKV
TRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEEN
REKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNA
QGSHWKQKRKFLPEDIGQAPI

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine

products references :

Human steroid receptors and erbA proto-oncogene products members of a new superfamily of enhancer binding proteins.Weinberger C., Giguere V., Hollenberg S., Rosenfeld M.G., Evans R.M.Cold Spring Harb. Symp. Quant. Biol. 51:759-772(1986) The c-erb-A gene encodes a thyroid hormone receptor.Weinberger C., Thompson C.C., Ong E.S., Lebo R., Gruol D.J., Evans R.M.Nature 324:641-646(1986) Structural analysis of human thyroid hormone receptor beta gene.Sakurai A., Nakai A., Degroot L.J.Mol. Cell. Endocrinol. 71:83-91(1990) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006)

ncbi gi num :

40806162

ncbi acc num :

NP_000452.2

ncbi gb acc num :

NM_000461.4

uniprot acc num :

P10828

ncbi mol weight :

68.75kD

ncbi pathways :

Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462); Nuclear Receptor Transcription Pathway (1269652); Nuclear Receptors Pathway (198848); SIDS Susceptibility Pathways (198901); Thyroid Hormone Signaling Pathway (946598)

ncbi summary :

The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq, Jul 2008]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1240

more info or order :

MyBioSource product webpage