product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Myosin-binding protein C, cardiac-type
catalog :
MBS956389
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS956389
products type :
Recombinant Protein
products full name :
Recombinant Rat Myosin-binding protein C, cardiac-type
products short name :
Myosin-binding protein C
products name syn :
C-protein, cardiac muscle isoform
other names :
myosin-binding protein C, cardiac-type; Myosin-binding protein C, cardiac-type; myosin-binding protein C, cardiac-type; myosin binding protein C, cardiac; C-protein, cardiac muscle isoform
products gene name :
Mybpc3
other gene names :
Mybpc3; Mybpc3; Cardiac MyBP-C
uniprot entry name :
MYPC_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
645-864; Provide the fragment include a Ig-like C2-type domain and a Fibronectin type-III domain
sequence length :
864
sequence :
PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIW
QKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETE
GRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQ
VNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGG
QPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEG
VAYEMRVYAVNAVGMSRPSPASQPF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
products references :
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.Cardiac myosin-binding protein C (MyBP-C) identification of protein kinase A and protein kinase C phosphorylation sites.Mohamed A.S., Dignam J.D., Schlender K.K.Arch. Biochem. Biophys. 358:313-319(1998)
ncbi gi num :
157824043
ncbi acc num :
NP_001099960.1
ncbi gb acc num :
NM_001106490.1
uniprot acc num :
P56741
ncbi mol weight :
26.1kD
ncbi pathways :
Dilated Cardiomyopathy Pathway (121476); Dilated Cardiomyopathy Pathway (121285); Hypertrophic Cardiomyopathy (HCM) Pathway (114014); Hypertrophic Cardiomyopathy (HCM) Pathway (106591); Muscle Contraction Pathway (1333549); Striated Muscle Contraction Pathway (1333550); Striated Muscle Contraction Pathway (198436)
uniprot summary :
MYBPC3: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Belongs to the immunoglobulin superfamily. MyBP family. Protein type: Myosin-binding. Cellular Component: A band; myofibril; sarcomere; striated muscle thick filament. Molecular Function: actin binding; identical protein binding; metal ion binding; myosin binding; myosin heavy chain binding; structural constituent of muscle. Biological Process: cardiac muscle contraction; cell adhesion; heart morphogenesis; muscle contraction; myosin filament assembly; regulation of heart contraction; regulation of heart rate; regulation of striated muscle contraction; sarcomere organization; ventricular cardiac muscle morphogenesis
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!