Recombinant Mouse Apolipoprotein A-IV | MyBioSource MBS956379 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Apolipoprotein A-IV

catalog :

MBS956379

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS956379

products type :

Recombinant Protein

products full name :

Recombinant Mouse Apolipoprotein A-IV

products short name :

Apolipoprotein A-IV

products name syn :

Apolipoprotein A4

other names :

apolipoprotein A-IV; Apolipoprotein A-IV; apolipoprotein A-IV; apolipoprotein A-IV; Apolipoprotein A4

products gene name :

Apoa4

other gene names :

Apoa4; Apoa4; Apoa-4; Apo-AIV; ApoA-IV

uniprot entry name :

APOA4_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-395

sequence length :

395

sequence :

EVTSDQVANVVWDYFTQLSNNAKEAVEQFQKTDVTQQLS
TLFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERV
KEEIKKELEDLRDRMMPHANKVTQTFGENMQKLQEHLKP
YAVDLQDQINTQTQEMKLQLTPYIQRMQTTIKENVDNLH
TSMMPLATNLKDKFNRNMEELKGHLTPRANELKATIDQN
LEDLRRSLAPLTVGVQEKLNHQMEGLAFQMKKNAEELQT
KVSAKIDQLQKNLAPLVEDVQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons.

products references :

Mouse apolipoprotein A-IV gene nucleotide sequence and induction by a high-lipid diet.Williams S.C., Bruckheimer S.M., Lusis A.J., LeBoeuf R.C., Kinniburgh A.J.Mol. Cell. Biol. 6:3807-3814(1986) Kinniburgh A.J.Genetic variation in mouse apolipoprotein A-IV due to insertion and deletion in a region of tandem repeats.Reue K., Leete T.H.J. Biol. Chem. 266:12715-12721(1991) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)

ncbi gi num :

110347473

ncbi acc num :

NP_031494.2

ncbi gb acc num :

NM_007468.2

uniprot acc num :

P06728

ncbi mol weight :

70.4kD

ncbi pathways :

Chylomicron-mediated Lipid Transport Pathway (1324269); Fat Digestion And Absorption Pathway (194386); Fat Digestion And Absorption Pathway (194324); Lipid Digestion, Mobilization, And Transport Pathway (1324265); Lipoprotein Metabolism Pathway (1324268); Metabolism Pathway (1324226); Metabolism Of Fat-soluble Vitamins Pathway (1324415); Metabolism Of Lipids And Lipoproteins Pathway (1324264); Metabolism Of Vitamins And Cofactors Pathway (1324401); Retinoid Metabolism And Transport Pathway (1324417)

uniprot summary :

APOA4: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Synthesized primarily in the intestine and secreted in plasma. Belongs to the apolipoprotein A1/A4/E family. Protein type: Lipid-binding; Secreted, signal peptide; Secreted; Cell adhesion; Endoplasmic reticulum. Cellular Component: cell surface; chylomicron; extracellular region; extracellular space. Molecular Function: antioxidant activity; cholesterol binding; cholesterol transporter activity; copper ion binding; lipid binding; phosphatidylcholine binding; protein homodimerization activity. Biological Process: cholesterol biosynthetic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; hydrogen peroxide catabolic process; innate immune response in mucosa; leukocyte adhesion; lipid homeostasis; lipid transport; lipoprotein metabolic process; multicellular organismal lipid catabolic process; neurite regeneration; phosphatidylcholine metabolic process; phospholipid efflux; positive regulation of fatty acid biosynthetic process; positive regulation of lipoprotein lipase activity; protein-lipid complex assembly; regulation of cholesterol absorption; regulation of cholesterol transport; removal of superoxide radicals; response to lipid hydroperoxide; reverse cholesterol transport; transport; triacylglycerol catabolic process

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage