catalog number :
MBS956069
products type :
Recombinant Protein
products full name :
Recombinant Dog Guanine nucleotide-binding protein G (s) subunit alpha (GNAS)
products short name :
[Guanine nucleotide-binding protein G (s) subunit alpha (GNAS)]
other names :
[guanine nucleotide-binding protein G(s) subunit alpha; Guanine nucleotide-binding protein G(s) subunit alpha; guanine nucleotide-binding protein G(s) subunit alpha; Adenylate cyclase-stimulating G alpha protein]
products gene name :
[GNAS]
other gene names :
[GNAS; GNAS; gnas1; GNAS1]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-394. Full Length of Mature Protein]
sequence :
GCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRAT
HRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQA
ARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE
LANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDE
GVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQD
LLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWI
QCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFK
SIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFP
EFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTAS
GDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQY
ELL
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Canis familiaris (Dog) (Canis lupus familiaris)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products description :
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5 exons. Some transcripts contains a differentially methylated region (DMR) at their 5 exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
ncbi acc num :
NP_001003263.1
ncbi gb acc num :
NM_001003263.1
ncbi mol weight :
45,665 Da
ncbi pathways :
Alcoholism Pathway (585569); Alcoholism Pathway (587116); Amoebiasis Pathway (167342); Amoebiasis Pathway (167191); Amphetamine Addiction Pathway (547617); Amphetamine Addiction Pathway (550546); Bile Secretion Pathway (193153); Bile Secretion Pathway (193095); Calcium Regulation In The Cardiac Cell Pathway (198600); Calcium Signaling Pathway (84100)
uniprot summary :
Guanine nucleotide-binding proteins (G proteins) function as transducers in numerous signaling pathways controlled by G protein-coupled receptors (GPCRs). Signaling involves the activation of adenylyl cyclases, resulting in increased levels of the signaling molecule cAMP. GNAS functions downstream of several GPCRs, including beta-adrenergic receptors. Stimulates the Ras signaling pathway via RAPGEF2.
size4 :
0.05 mg (Baculovirus)
size7 :
0.05 mg (Mammalian-Cell)
size9 :
0.1 mg (Baculovirus)
size11 :
0.5 mg (Baculovirus)
size13 :
0.1 mg (Mammalian-Cell)
size14 :
1 mg (Baculovirus)