catalog number :
MBS956041
products type :
Recombinant Protein
products full name :
Recombinant Mouse Tryptophan 2,3-dioxygenase
products short name :
Tryptophan 2,3-dioxygenase
products name syn :
Tryptamin 2,3-dioxygenase
other names :
tryptophan 2,3-dioxygenase; Tryptophan 2,3-dioxygenase; tryptophan 2,3-dioxygenase; tryptophan 2,3-dioxygenase; Tryptamin 2,3-dioxygenase
products gene name :
Tdo2
other gene names :
Tdo2; Tdo2; TO; TDO; chky; AA407491; Tdo; TDO; TO; TRPO
uniprot entry name :
T23O_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-406; full length
sequence :
MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGG
LIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQA
YELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHR
VVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSL
QFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKS
EQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGL
EEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRH
DYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLT
SLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYL
RSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLY
TAEYSDSSYFSSDESD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin.
products references :
Novoradovsky A., Goldman D. Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
ncbi acc num :
NP_064295.2
ncbi gb acc num :
NM_019911.2
ncbi pathways :
Amino Acid Metabolism Pathway (198416); Histidine, Lysine, Phenylalanine, Tyrosine, Proline And Tryptophan Catabolism Pathway (1324424); Metabolic Pathways (132962); Metabolism Pathway (1324226); Metabolism Of Amino Acids And Derivatives Pathway (1324419); NAD Biosynthesis II (from Tryptophan) Pathway (142866); Tryptophan Catabolism Pathway (1324429); Tryptophan Metabolism Pathway (83163); Tryptophan Metabolism Pathway (198332); Tryptophan Metabolism Pathway (332)
uniprot summary :
TDO2: Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Belongs to the tryptophan 2,3-dioxygenase family. Protein type: Amino Acid Metabolism - tryptophan; Oxidoreductase; EC 1.13.11.11. Molecular Function: amino acid binding; dioxygenase activity; heme binding; metal ion binding; oxidoreductase activity; oxygen binding; tryptophan 2,3-dioxygenase activity. Biological Process: tryptophan catabolic process; tryptophan catabolic process to acetyl-CoA; tryptophan catabolic process to kynurenine; tryptophan metabolic process
size5 :
0.05 mg (Baculovirus)