protein

Recombinant Human 60 kDa heat shock protein, mitochondrial (HSPD1)

MBS955999

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human 60 kDa heat shock protein, mitochondrial (HSPD1)

60 kDa heat shock protein, mitochondrial (HSPD1)

60 kDa heat shock protein, mitochondrial; 60 kDa chaperonin; Chaperonin 60; CPN60; Heat shock protein 60; HSP-60; Hsp60; HuCHA60; Mitochondrial matrix protein P1; P60 lymphocyte protein

60 kDa heat shock protein, mitochondrial; 60 kDa heat shock protein, mitochondrial; 60 kDa heat shock protein, mitochondrial; chaperonin 60; 60 kDa chaperonin; heat shock protein 65; P60 lymphocyte protein; mitochondrial matrix protein P1; short heat shock protein 60 Hsp60s1; heat shock 60kDa protein 1 (chaperonin); 60 kDa chaperonin; Chaperonin 60; CPN60; Heat shock protein 60; HSP-60; Hsp60; HuCHA60; Mitochondrial matrix protein P1; P60 lymphocyte protein

HSPD1

HSPD1; HSP60

HSPD1; HSPD1; HLD4; CPN60; GROEL; HSP60; HSP65; SPG13; HSP-60; HuCHA60; HSP60; CPN60; HSP-60; Hsp60

CH60_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

27-573

573

AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIE
QSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRG
VMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEI
GNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDR
GYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPA
LEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVA
VKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQ
PHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQ
LDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNE
KKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLT
PANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKI
MQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAA
GVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGM
F

>90%

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Species: Homo sapiens (Human)

Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.

31542947

NP_002147.2

NM_002156.4

P10809

61,055 Da

Legionellosis Pathway (469200); Legionellosis Pathway (469186); Metabolism Of Proteins Pathway (106230); Mitochondrial Protein Import Pathway (576261); RNA Degradation Pathway (117291); RNA Degradation Pathway (116127); SIDS Susceptibility Pathways (198901); Tuberculosis Pathway (213780); Tuberculosis Pathway (213743); Type I Diabetes Mellitus Pathway (83095)

This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13. [provided by RefSeq, Jun 2010]

HSP60: Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. Interacts with HRAS. Interacts with HBV protein X and HTLV-1 protein p40tax. Belongs to the chaperonin (HSP60) family. Protein type: Mitochondrial; Chaperone. Chromosomal Location of Human Ortholog: 2q33.1. Cellular Component: extracellular space; cell surface; protein complex; membrane; mitochondrion; mitochondrial matrix; early endosome; cytoplasm; mitochondrial inner membrane; plasma membrane; lipopolysaccharide receptor complex; coated pit; cytosol; cyclin-dependent protein kinase activating kinase holoenzyme complex; secretory granule. Molecular Function: protein binding; lipopolysaccharide binding; p53 binding; chaperone binding; ubiquitin protein ligase binding; ATPase activity; double-stranded RNA binding; unfolded protein binding; DNA replication origin binding; ATP binding; single-stranded DNA binding. Biological Process: B cell proliferation; caspase activation; viral reproduction; T cell activation; protein stabilization; B cell activation; positive regulation of apoptosis; positive regulation of interleukin-12 production; protein maturation; isotype switching to IgG isotypes; positive regulation of interleukin-6 production; B cell cytokine production; response to unfolded protein; positive regulation of interleukin-10 production; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interferon-gamma production; de novo protein folding; protein refolding; positive regulation of T cell mediated immune response to tumor cell; positive regulation of T cell activation; chaperone-mediated protein complex assembly; positive regulation of interferon-alpha production; positive regulation of macrophage activation; negative regulation of apoptosis. Disease: Spastic Paraplegia 13, Autosomal Dominant; Leukodystrophy, Hypomyelinating, 4

0.05 mg (E-Coli)

180 USD

0.2 mg (E-Coli)

490

0.5 mg (E-Coli)

715

0.05 mg (Baculovirus)

950

1 mg (E-Coli)

1170