protein

Recombinant Mouse Glucose-6-phosphate isomerase

MBS955811

0.05 mg (Yeast)

260 USD

Recombinant Protein

Recombinant Mouse Glucose-6-phosphate isomerase

Glucose-6-phosphate isomerase

Autocrine motility factor; AMF; Neuroleukin; NLK; Phosphoglucose isomerase; PGI; Phosphohexose isomerase; PHI

Glucose-6-phosphate isomerase; glucose-6-phosphate isomerase; glucose phosphate isomerase 1; Autocrine motility factor; AMF; Neuroleukin; NLK; Phosphoglucose isomerase; PGI; Phosphohexose isomerase; PHI

Gpi

Gpi1; Gpi; MF; NK; Amf; Gpi; Nlk; Org; Pgi; Phi; Gpi-1; Gpi1s; Gpi-1r; Gpi-1s; Gpi-1t; Gpi1-r; Gpi1-s; Gpi1-t; NK/GPI; Gpi1; GPI; AMF; NLK; PGI; PHI

G6PI_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-558; Full length

558

VTSHDSSTNGLISFIKQQRDTKLE
AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNF
SLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEA
ARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDV
MPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGI
GGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTL
ASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKD
PSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRY
SLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLE
KNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYF
QQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAF
YQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFL
AQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFE
GNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDIN
SFDQWGVELGKQLAKKIEPELEGSSA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.

Molecular cloning and expression of neuroleukin, a neurotrophic factor for spinal and sensory neurons.Gurney M.E., Heinrich S.P., Lee M.R., Yin H.-S.Science 234:566-574(1986) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Lubec G., Klug S., Kang S.U. Mouse glucose-6-phosphate isomerase and neuroleukin have identical 3' sequences.Faik P., Walker J.I.H., Redmill A.A.M., Morgan M.J.Nature 332:455-456(1988) Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E.Biochem. Biophys. Res. Commun. 336:496-506(2005) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) The crystal structure of mouse phosphoglucose isomerase at 1.6A resolution and its complex with glucose 6-phosphate reveals the catalytic mechanism of sugar ring opening.Solomons J.T.G., Zimmerly E.M., Burns S., Krishnamurthy N., Swan M.K., Krings S., Muirhead H., Chirgwin J., Davies C.J. Mol. Biol. 342:847-860(2004) Tumor cell autocrine motility factor is the neuroleukin/phosphohexose isomerase polypeptide.Watanabe H., Takehana K., Date M., Shinozaki T., Raz A.Cancer Res. 56:2960-2963(1996) Crystal structures of mouse autocrine motility factor in complex with carbohydrate phosphate inhibitors provide insight into structure-activity relationship of the inhibitors.Tanaka N., Haga A., Naba N., Shiraiwa K., Kusakabe Y., Hashimoto K., Funasaka T., Nagase H., Raz A., Nakamura K.T.J. Mol. Biol. 356:312-324(2006)

NP_032181.2

P06745

64.6kD

Amino Sugar And Nucleotide Sugar Metabolism Pathway (83178); Amino Sugar And Nucleotide Sugar Metabolism Pathway (350); Carbon Metabolism Pathway (815838); Carbon Metabolism Pathway (817567); GDP-mannose Biosynthesis Pathway (142850); GDP-mannose Biosynthesis I Pathway (142849); Gene Expression Pathway (1323801); Generic Transcription Pathway (1323802); Gluconeogenesis Pathway (1324231); Glucose Metabolism Pathway (1324229)

This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. [provided by RefSeq, Jan 2014]

G6PI: belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. A dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. Functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Protein type: EC 5.3.1.9; Isomerase; Apoptosis; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - pentose phosphate pathway; Carbohydrate Metabolism - starch and sucrose; Cytokine. Cellular Component: cytoplasm; cytosol; extracellular region; extracellular space; membrane; myelin sheath; neuron projection; nucleoplasm; plasma membrane. Molecular Function: cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; intramolecular transferase activity; isomerase activity; monosaccharide binding; protein binding; ubiquitin protein ligase binding. Biological Process: aldehyde catabolic process; angiogenesis; carbohydrate metabolic process; erythrocyte homeostasis; gluconeogenesis; glucose 6-phosphate metabolic process; glucose homeostasis; glycolysis; in utero embryonic development; mesoderm formation; methylglyoxal biosynthetic process; negative regulation of caspase activity; negative regulation of neuron apoptosis

0.05 mg (Yeast)

260 USD

0.05 mg (E-Coli)

305

0.2 mg (E-Coli)

580

0.2 mg (Yeast)

600

0.05 mg (Baculovirus)

950