Recombinant Human NKG2-C type II integral membrane protein | MyBioSource MBS955746 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human NKG2-C type II integral membrane protein

catalog :

MBS955746

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS955746

products type :

Recombinant Protein

products full name :

Recombinant Human NKG2-C type II integral membrane protein

products short name :

NKG2-C type II integral membrane

products name syn :

CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159c

other names :

NKG2-C type II integral membrane protein; NKG2-C type II integral membrane protein; NKG2-C type II integral membrane protein; killer cell lectin like receptor C2; CD159 antigen-like family member C; NK cell receptor C; NKG2-C-activating NK receptor; CD_antigen: CD159c

products gene name :

KLRC2

other gene names :

KLRC2; KLRC2; NKG2C; CD159c; NKG2-C; NKG2C

uniprot entry name :

NKG2C_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

94-231

sequence length :

231

sequence :

IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIG
KERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSS
WIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQ
VNRLKSAQCGSSMIYHCKHKL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

products references :

DNA sequence analysis of NKG2, a family of related cDNA clones encoding type II integral membrane proteins on human natural killer cells.Houchins J.P., Yabe T., McSherry C., Bach F.H.J. Exp. Med. 173:1017-1020(1991) The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex.Glienke J., Sobanov Y., Brostjan C., Steffens C., Nguyen C., Lehrach H., Hofer E., Francis F.Immunogenetics 48:163-173(1998) Conservation and variation in human and common chimpanzee CD94 and NKG2 genes.Shum B.P., Flodin L.R., Muir D.G., Rajalingam R., Khakoo S.I., Cleland S., Guethlein L.A., Uhrberg M., Parham P.J. Immunol. 168:240-252(2002) Biassoni R. The finished DNA sequence of human chromosome 12.Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.Nature 440:346-351(2006) The structural basis for intramembrane assembly of an activating immunoreceptor complex.Call M.E., Wucherpfennig K.W., Chou J.J.Nat. Immunol. 11:1023-1029(2010)

ncbi gi num :

75709169

ncbi acc num :

NP_002251.2

ncbi gb acc num :

NM_002260.3

uniprot acc num :

P26717

ncbi mol weight :

31.78kD

ncbi pathways :

Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); Natural Killer Cell Mediated Cytotoxicity Pathway (83079); Natural Killer Cell Mediated Cytotoxicity Pathway (490)

ncbi summary :

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The group, designated KLRC (NKG2) are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The KLRC (NKG2) gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. KLRC2 alternative splice variants have been described but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

uniprot summary :

KLRC2: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 12p13. Cellular Component: integral to plasma membrane; plasma membrane; receptor complex. Molecular Function: carbohydrate binding; protein binding; transmembrane receptor activity. Biological Process: cellular defense response; innate immune response; natural killer cell mediated immunity; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

875

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1100

more info or order :

MyBioSource product webpage