protein

Recombinant Human Muscarinic acetylcholine receptor M3

MBS955742

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human Muscarinic acetylcholine receptor M3

Muscarinic acetylcholine receptor M3

muscarinic acetylcholine receptor M3; Muscarinic acetylcholine receptor M3; muscarinic acetylcholine receptor M3; cholinergic receptor, muscarinic 3

CHRM3

CHRM3; CHRM3; HM3; PBS; EGBRS

ACM3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

253-492

590

RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCS
SYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQD
HSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVL
KLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKL
QAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSV
GKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKE
KKAAQT

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors.Peralta E.G., Ashkenazi A., Winslow J.W., Smith D.H., Ramachandran J., Capon D.J.EMBO J. 6:3923-3929(1987) Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes.Bonner T.I., Young A.C., Brann M.R., Buckley N.J.Neuron 1:403-410(1988) Human-specific amino acid changes found in 103 protein-coding genes.Kitano T., Liu Y.-H., Ueda S., Saitou N.Mol. Biol. Evol. 21:936-944(2004) cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Puhl H.L. III, Ikeda S.R., Aronstam R.S. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.Speek M.Mol. Cell. Biol. 21:1973-1985(2001) Mutation of carboxyl-terminal threonine residues in human M3 muscarinic acetylcholine receptor modulates the extent of sequestration and desensitization.Yang J., Williams J.A., Yule D.I., Logsdon C.D.Mol. Pharmacol. 48:477-485(1995) Muscarinic acetylcholine receptor M3 mutation causes urinary bladder disease and a prune-belly-like syndrome.Weber S., Thiele H., Mir S., Toliat M.R., Sozeri B., Reutter H., Draaken M., Ludwig M., Altmuller J., Frommolt P., Stuart H.M., Ranjzad P., Hanley N.A., Jennings R., Newman W.G., Wilcox D.T., Thiel U., Schlingmann K.P., Beetz R., Hoyer P.F., Konrad M., Schaefer F., Nurnberg P., Woolf A.S.Am. J. Hum. Genet. 89:668-674(2011) The muscarinic M3 acetylcholine receptor exists as two differently sized complexes at the plasma membrane.Patowary S., Alvarez-Curto E., Xu T.R., Holz J.D., Oliver J.A., Milligan G., Raicu V.Biochem. J. 452:303-312(2013) Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal.Iverson H.A., Fox D. III, Nadler L.S., Klevit R.E., Nathanson N.M.J. Biol. Chem. 280:24568-24575(2005)

4502819

NP_000731.1

NM_000740.2

P20309

28.6kD

Acetylcholine Regulates Insulin Secretion Pathway (1270104); Amine Ligand-binding Receptors Pathway (1269553); Calcium Regulation In The Cardiac Cell Pathway (198906); Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459); Cholinergic Synapse Pathway (217716); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544)

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. [provided by RefSeq, Jul 2008]

mAChR M3: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. Defects in CHRM3 are the cause of Eagle-Barrett syndrome (EGBRS). EGBRS is a syndrome characterized by thin abdominal musculature with overlying lax skin, cryptorchism, megacystis with disorganized detrusor muscle, and urinary tract abnormalities. Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM3 sub-subfamily. Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1. Chromosomal Location of Human Ortholog: 1q43. Cellular Component: asymmetric synapse; basolateral plasma membrane; cell junction; dendrite; integral to plasma membrane; nerve terminal; plasma membrane; postsynaptic membrane; synapse. Molecular Function: acetylcholine binding; drug binding; G-protein coupled acetylcholine receptor activity; phosphoinositide phospholipase C activity; protein binding; receptor activity. Biological Process: acetylcholine receptor signaling, muscarinic pathway; cell proliferation; energy reserve metabolic process; G-protein coupled receptor protein signaling pathway; muscarinic acetylcholine receptor, adenylate cyclase inhibiting pathway; muscarinic acetylcholine receptor, phospholipase C activating pathway; nervous system development; positive regulation of smooth muscle contraction; protein modification process; regulation of insulin secretion; regulation of vascular smooth muscle contraction; saliva secretion; signal transduction; smooth muscle contraction; synaptic transmission, cholinergic. Disease: Abdominal Muscles, Absence Of, With Urinary Tract Abnormality And Cryptorchidism

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070