product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Insulin-like growth factor-binding protein 1
catalog :
MBS955683
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS955683
products type :
Recombinant Protein
products full name :
Recombinant Mouse Insulin-like growth factor-binding protein 1
products short name :
Insulin-like growth factor-binding protein 1
other names :
insulin-like growth factor-binding protein 1; Insulin-like growth factor-binding protein 1; insulin-like growth factor-binding protein 1; insulin-like growth factor binding protein 1
products gene name :
Igfbp1
other gene names :
Igfbp1; Igfbp1; Igfbp-1; IBP-1; IGF-binding protein 1; IGFBP-1
uniprot entry name :
IBP1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
26-272
sequence length :
272
sequence :
APQPWHCAPCTAERLGLCPPVPASCPEISRPAGCGCCPT
CALPMGAACGVATARCAQGLSCRALPGEPRPLHALTRGQ
GACVPEPAAPATSTLFSSQHEEAKAAVVSADELSESPEM
TEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIAD
LKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCN
KNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETR
GDPNCHQYFNVHN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
products references :
cDNA cloning and mRNA expression of the six mouse insulin-like growth factor binding proteins.Schuller A.G.P., Groffen C., van Neck J.W., Zwarthoff E.C., Drop S.L.S.Mol. Cell. Endocrinol. 104:57-66(1994) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.Structure and localization of the IGFBP-1 gene and its expression during liver regeneration.Lee J., Greenbaum L., Haber B.A., Nagle D., Lee V., Miles V., Mohn K.L., Bucan M., Taub R.Hepatology 19:656-665(1994)
ncbi gi num :
160358847
ncbi acc num :
NP_032367.3
ncbi gb acc num :
NM_008341.4
uniprot acc num :
P47876
ncbi mol weight :
42.83kD
ncbi pathways :
Metabolism Of Proteins Pathway (1324154); Myometrial Relaxation And Contraction Pathways (198333); Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway (1324217)
uniprot summary :
IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. Protein type: Secreted; Secreted, signal peptide. Cellular Component: extracellular region; extracellular space. Molecular Function: growth factor binding; insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding. Biological Process: regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!